DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and Glyatl1

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001119750.1 Gene:Glyatl1 / 309227 RGDID:1564894 Length:296 Species:Rattus norvegicus


Alignment Length:285 Identity:55/285 - (19%)
Similarity:99/285 - (34%) Gaps:88/285 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LYLKDWPSNCVGYFWLDNYLRWMDQNPTLKHLNFYTLDNDWRSDGLFILVHRYQLFFSNLSKQKT 86
            :|.|| |..|:.:....:.:.|.      :||                          .:...::
  Rat    77 IYSKD-PKQCLAFLGTPDVINWK------QHL--------------------------QIQSSQS 108

  Fly    87 DLEVALKQLDWSRGFKVSAIHEIHHKIYKQLALDLGLNMDREMNTIMYILNREEAERLQIQCP-- 149
            .|..|:  .|::.|.||..         |:....|.:..:.....:.::|  |:.|.|. :.|  
  Rat   109 SLNEAI--TDFAAGKKVKV---------KRTQCILYMMPETAKKLVPFLL--EDTENLD-RNPGR 159

  Fly   150 ------DGYFLDKVRLEHADLINDLW----SARHPGSLKLIQMLITYNTNVGLYEKELGSLCAWC 204
                  :.:.|..:.:.||.|::..|    |.|   |.:.|:..|....:..|...| |:..:|.
  Rat   160 PRAIDQEMFKLSSLDVTHAALVDKFWQFGGSER---SQRFIERCIQIFPSSCLLGPE-GTPVSWA 220

  Fly   205 LRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAI-ATDLQQDITALVNINNS-AACRVFEKLNFR 267
            |..|:|.:.....:|.::.:||       ||..| |..|..|.......|:: .|.:|.:|::..
  Rat   221 LMDQTGEIRMAGTVPDYRAQGL-------ISHIIYAQTLVMDKRGYPVYNHTEKANKVIQKMSHT 278

  Fly   268 LIQDEHYYWSMIKPAAGGQISWPCD 292
            |                ..:..|||
  Rat   279 L----------------NHVPMPCD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 21/89 (24%)
Glyatl1NP_001119750.1 Gly_acyl_tr_N 1..206 CDD:399190 31/178 (17%)
Gly_acyl_tr_C 207..295 CDD:117021 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.