DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and Glyat

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001009648.1 Gene:Glyat / 293779 RGDID:1307163 Length:296 Species:Rattus norvegicus


Alignment Length:224 Identity:42/224 - (18%)
Similarity:79/224 - (35%) Gaps:69/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RWMDQNPTL---------KHLNFYTLDNDWRSDGLFILVHRYQLFFSNLSKQKTDLEVAL---KQ 94
            :|.|.|..:         ..|:|||              :.||::    ||...:.:..|   :.
  Rat    49 KWPDFNTVVVRPQEQEMKDDLDFYT--------------NTYQIY----SKDPENCQEFLGSSEV 95

  Fly    95 LDWSRGFKVSAIHEIHHKIYKQLALDLGLNMDREMNTIMYILNREEAERLQIQCPDG-------- 151
            ::|.:..::.:.....:|..:.||....|.:....| |:|::: |...:|.....|.        
  Rat    96 INWKQHLQIQSSQSHLNKAIQNLASIHSLQVKHSEN-ILYVVS-ETVRKLFPSLLDTKNLSPGSG 158

  Fly   152 ---------YFLDKVRLEHADLINDLW-SARHPGSLKLIQMLITYNTNVGLYEKELGSLC----- 201
                     :.|..:.:.||.|:|..| ...:..|.:.|:..|          |...|.|     
  Rat   159 KPKAINQEMFKLSSLDVTHAALVNKFWLFGGNERSQRFIERCI----------KNFPSSCVLGPE 213

  Fly   202 ----AWCLRLQSGFLGALEVLPTHQRRGL 226
                :|.|..|:|.:.....:|.::.:||
  Rat   214 GTPASWTLMDQTGEMRMGGTVPQYRAQGL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 10/47 (21%)
GlyatNP_001009648.1 Gly_acyl_tr_N 1..206 CDD:399190 33/186 (18%)
Gly_acyl_tr_C 207..295 CDD:117021 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.