DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and GLYATL2

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_659453.3 Gene:GLYATL2 / 219970 HGNCID:24178 Length:294 Species:Homo sapiens


Alignment Length:305 Identity:65/305 - (21%)
Similarity:117/305 - (38%) Gaps:67/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NLKDLQILYL---KDWPSNCVGYFWLDNYLRWMDQNPTLKHLNFYTLDNDWRSDGLFILVHRYQL 76
            |.:.|||||.   |..|.:...|..:.|.   .|:||    .|...|.:.|..         ||:
Human     6 NSQKLQILYKSLEKSIPESIKVYGAIFNI---KDKNP----FNMEVLVDAWPD---------YQI 54

  Fly    77 FFSNLSKQ--KTD-----------------LEVALKQ---LDWSRGFKVSAIHEIHHKIYKQLAL 119
            ..:...||  |.|                 ||..|..   :.|.:..::....|...:..:::|.
Human    55 VITRPQKQEMKDDQDHYTNTYHIFTKAPDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVAT 119

  Fly   120 DLGLNMDREMNTIMYI---------LNREEAERLQIQCPD------GYFLDKVRLEHADLINDLW 169
            ...:.:| .|.||::|         .:.::.|..::...:      ..|||   ..||.|:|:.|
Human   120 SKSVQVD-YMKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLD---ASHAGLVNEHW 180

  Fly   170 S-ARHPGSLKLIQMLITYNTNVGLYEKELGSLCAWCLRLQSGFLGALEVLPTHQRRGLGLVVAAA 233
            : .::..|||.|:..:......|:...| |.|.:|.:..||..|.....:|.::.:|..|.:...
Human   181 AFGKNERSLKYIERCLQDFLGFGVLGPE-GQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYH 244

  Fly   234 ISKAIATDLQQDITALVNI--NNSAACRVFEKLNFRLIQDEHYYW 276
            :.|.::   |::|....::  ||..:.:....|.|::.....:.|
Human   245 LEKYLS---QKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 19/90 (21%)
GLYATL2NP_659453.3 Gly_acyl_tr_N 10..199 CDD:310541 45/208 (22%)
Gly_acyl_tr_C 202..290 CDD:117021 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.