DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and F43H9.4

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_505068.1 Gene:F43H9.4 / 179182 WormBaseID:WBGene00018400 Length:297 Species:Caenorhabditis elegans


Alignment Length:179 Identity:42/179 - (23%)
Similarity:70/179 - (39%) Gaps:43/179 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 NMDREM---NTIMYILNREEAERLQ----IQCPDGYFLDKVRLEHADLINDLWSARHPGSLKLIQ 181
            |::.|:   :|..:.:|..:..:.:    ...||||.:|     ..:..||:        :|::.
 Worm   125 NINAEVQNKSTHFFAMNESQIFKYRNYGDTTLPDGYSID-----IPESTNDV--------MKIVG 176

  Fly   182 MLITYNTNVGLYEKELGSLCAWCLR--------LQS---GFLGALEVLPTHQRRGLG--LVVAAA 233
            ..||  .|..|.|::|....:.|:|        :.|   |.|..|.|...|:.:.||  |.:.||
 Worm   177 SSIT--PNAKLVEEKLRRFPSLCVRKGDELVGFISSETHGALAHLHVFDGHRGKNLGEKLEIGAA 239

  Fly   234 ISKAIATDLQQ----DIT---ALVNINNSAACRVFEKLNFRLIQDEHYY 275
             ..||...::.    |.|   .|.....|....|.|.....|:.|::.|
 Worm   240 -KMAIENGMRPCKFIDTTNSFFLEKAKKSKLMDVVESNGTPLVFDQNVY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 28/107 (26%)
F43H9.4NP_505068.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.