DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and ZK185.3

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001370684.1 Gene:ZK185.3 / 177220 WormBaseID:WBGene00022683 Length:293 Species:Caenorhabditis elegans


Alignment Length:156 Identity:32/156 - (20%)
Similarity:61/156 - (39%) Gaps:40/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 IQCPDGYFLDKVRLEHADLINDLWSARHPGSLKLIQMLITYNTNVGLYEKE-LGSLCAWCLRLQS 209
            |..|..:.:...|||.|:::|..|....|..:              |.:|| :..|...|:..:.
 Worm   156 ITLPVSFSIGSTRLEDAEIVNSTWKFATPEDI--------------LQQKEKIQRLPTACIFHEE 206

  Fly   210 --------GFLGALE---VLPTHQRRGLGLVVAAAISKAIATDLQQDITAL--VNINNSAACRVF 261
                    |..|.|.   .:|.::.||.|.::..:|   ::...::.||.:  |.::|....:  
 Worm   207 KPIAFEMIGLHGQLSHQYTMPGYRNRGFGAIIENSI---VSKCFREGITPVKSVELSNEPVLK-- 266

  Fly   262 EKLNFRLIQDEHYYWSMIKPAAGGQI 287
                 |.:  ||..|.::|...|.::
 Worm   267 -----RSL--EHPLWEIVKDENGDKV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 20/101 (20%)
ZK185.3NP_001370684.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR20958
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.