DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and Glyat

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_666047.1 Gene:Glyat / 107146 MGIID:2147502 Length:296 Species:Mus musculus


Alignment Length:311 Identity:61/311 - (19%)
Similarity:110/311 - (35%) Gaps:93/311 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NLKDLQILYLKDWPS-NCVGYFWLDNYLRWMDQNPTLKHLNFYTLDNDWRSDGLFILVHRYQLFF 78
            |||.|    :..||. |.|       .:|..:|..| ..|:||              ::.||:: 
Mouse    42 NLKAL----VDKWPDFNTV-------VVRPQEQEMT-DDLDFY--------------INTYQVY- 79

  Fly    79 SNLSKQKTDLEVALKQ---LDWSRGFKVSAIHEIHHKIYKQLALDLGLNMDREMNTIMYILNREE 140
               ||...:.:..|:.   ::|.:..::.:.....:|..:.||......:....| |:|:    .
Mouse    80 ---SKDPQNCQEFLESSEVINWKQHLQIQSSQSHLNKTIQNLASIQSFQIKHSEN-ILYV----S 136

  Fly   141 AERLQIQCP--------------------DGYFLDKVRLEHADLINDLW-SARHPGSLKLIQMLI 184
            :|.::...|                    |.:.|..:.:.||.|:|..| ...:..|.:.|:..|
Mouse   137 SETIKKLFPSLLDTKNLSTGSGKPKAIDQDKFKLSSLDVVHAALVNKFWLFGGNERSQRFIERCI 201

  Fly   185 TYNTNVGLYEKELGSLC---------AWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIAT 240
                      |...|.|         :|.|..|:|.:.....:|.::.:||...|..: ...|.|
Mouse   202 ----------KNFPSSCVLGPEGTPASWTLMDQTGEMRMGGTMPEYRLQGLVSFVVHS-QDQIMT 255

  Fly   241 DLQQDITALVNINNSAACRVFEKLNFRLIQDEHYYWSMIKPAAGGQISWPC 291
            .....:.:....:|.|    .:|:::.|   :|    :..|.|..|  |.|
Mouse   256 KRGYPVYSHTEKSNIA----MQKMSYTL---QH----LPMPCAWNQ--WKC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 18/96 (19%)
GlyatNP_666047.1 Gly_acyl_tr_N 11..206 CDD:283638 39/208 (19%)
Gly_acyl_tr_C 207..295 CDD:117021 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.