DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17681 and GLYATL1B

DIOPT Version :9

Sequence 1:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001342495.1 Gene:GLYATL1B / 100287520 HGNCID:37865 Length:302 Species:Homo sapiens


Alignment Length:290 Identity:47/290 - (16%)
Similarity:96/290 - (33%) Gaps:93/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NPTLKHLNFYTLDNDW--------------RSDGLFILVHRYQLFFSNLSKQKTDLEVALKQ--- 94
            ||    .|...|.:.|              .:|.:....:.|::|    ||.....:..||.   
Human    38 NP----FNMEVLVDSWPEYQMVIIRPQKQEMTDDMDSYTNVYRVF----SKDPQKSQEVLKNSEI 94

  Fly    95 LDWSRGFKVSAIHEIHHKIYKQLALDLGLNMDREMNTI-----------------MYILNREEA- 141
            ::|.:..::....|         :|..|:......|::                 :|..|:.:. 
Human    95 INWKQKLQIQGFQE---------SLGEGIRAAAFSNSVKVEHSRALLFVTEDILKLYATNKSKLG 150

  Fly   142 ---------ERLQIQCPDGYFLDKVRLEHADLINDLWS-ARHPGSLKLIQMLITYNTNVGLYEKE 196
                     :.|:.:.|: :...::.:.::.|:||.|. ..:..||:.|             ::.
Human   151 SWAETGHPDDELESETPN-FKYAQLNVSYSGLVNDNWKLGMNKRSLRYI-------------KRC 201

  Fly   197 LGSLCAWCLRLQSGF------------LGALEVLPTHQRRGLGLVVAAAISKAIATDLQQDITAL 249
            ||:|.|.|:....|.            :|....:..::|||.|..:.....|.:.   |::|...
Human   202 LGALPAACMLGPEGVPVSWVTMDPSCEIGMGYSVEKYRRRGNGTRLIMRCMKYLC---QKNIPFY 263

  Fly   250 VNI--NNSAACRVFEKLNFRLIQDEHYYWS 277
            .::  .|....|....|.|.....:.:.|:
Human   264 GSVLEENQGVIRKTSALGFLEASCQWHQWN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17681NP_724098.2 FR47 189..277 CDD:117022 18/101 (18%)
GLYATL1BNP_001342495.1 Gly_acyl_tr_N 10..207 CDD:310541 31/199 (16%)
NAT_SF 208..296 CDD:327402 15/89 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.