Sequence 1: | NP_523593.5 | Gene: | Socs36E / 35085 | FlyBaseID: | FBgn0041184 | Length: | 737 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001365861.1 | Gene: | SOCS3 / 9021 | HGNCID: | 19391 | Length: | 225 | Species: | Homo sapiens |
Alignment Length: | 227 | Identity: | 57/227 - (25%) |
---|---|---|---|
Similarity: | 88/227 - (38%) | Gaps: | 64/227 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 435 PAGGAGHAGIGAARNMTVHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLR 499
Fly 500 DSAQEEFLFSVTFRKYGRSLHARIEQSGHKFS-------------FDCHDPCVFTAPTVTGLLEH 551
Fly 552 YKDPACVMFF-----EPCLTIPLH-----------RRQTF---------------------SLQQ 579
Fly 580 LSRATIVSN-TSYDGINQMELPGRLKSYLKEY 610 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Socs36E | NP_523593.5 | SH2 | 463..563 | CDD:301589 | 33/117 (28%) |
SOCS | 575..626 | CDD:295349 | 13/58 (22%) | ||
SOCS3 | NP_001365861.1 | Kinase inhibitory region (KIR) | 22..33 | 2/11 (18%) | |
Extended SH2 subdomain (ESS) | 34..45 | 2/10 (20%) | |||
SH2_SOCS3 | 35..135 | CDD:198247 | 32/109 (29%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 131..162 | 4/30 (13%) | |||
SOCS_SOCS3 | 184..225 | CDD:239706 | 13/40 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165142959 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4566 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |