DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and Socs3

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_446017.1 Gene:Socs3 / 89829 RGDID:621087 Length:225 Species:Rattus norvegicus


Alignment Length:227 Identity:58/227 - (25%)
Similarity:86/227 - (37%) Gaps:64/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 PAGGAGHAGIGAARNMTVHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLR 499
            ||.|.......:.|..|..|:.:: ..:|..:.|:..|.|||..:...||..||..:|.||||:|
  Rat     8 PAAGMSRPLDTSLRLKTFSSKSEY-QLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIR 71

  Fly   500 DSAQEEFLFSVTFRKYGRSLHARIEQSGHKFS-------------FDCHDPCVFTAPTVTGLLEH 551
            ||:.:...|:::......:.:.||:..|..||             |||          |..|:.|
  Rat    72 DSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDC----------VLKLVHH 126

  Fly   552 YKDPACVMFF-----EPCL---------------------------TIPLHRRQTFS-----LQQ 579
            |..|.....|     ||..                           .|||...:..|     ||.
  Rat   127 YMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQH 191

  Fly   580 LSRATIVSN-TSYDGINQMELPGRLKSYLKEY 610
            |.|.|:..: .||:.:.|  |||.::.:|.:|
  Rat   192 LCRKTVNGHLDSYEKVTQ--LPGPIREFLDQY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 33/117 (28%)
SOCS 575..626 CDD:295349 14/42 (33%)
Socs3NP_446017.1 Kinase inhibitory region (KIR) 22..33 2/11 (18%)
Extended SH2 subdomain (ESS) 34..45 2/10 (20%)
SH2_SOCS3 35..135 CDD:198247 32/109 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..160 2/18 (11%)
SOCS_SOCS3 184..225 CDD:239706 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336659
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.