DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and SOCS1

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_003736.1 Gene:SOCS1 / 8651 HGNCID:19383 Length:211 Species:Homo sapiens


Alignment Length:228 Identity:64/228 - (28%)
Similarity:92/228 - (40%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 VTVVTEP---------APQSPQTPPRPRPLATV-APAGGAGHAGIGAARNMTVHSQIDFMHCLVP 464
            |:...||         :..||..|.||||...| |||.|..|     .|....|:          
Human    13 VSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTH-----FRTFRSHA---------- 62

  Fly   465 DLEKITNSS-------FYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHAR 522
            |..:||.:|       ||||.:..:.|...|..:|.||||:|||.|....|:::.:........|
Human    63 DYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIR 127

  Fly   523 IEQSGHKF-------SFDCHDPCVFTAPTVTGLLEHYKDPACVMFFEPCLTIPLHRRQTFSLQQL 580
            :.....:|       ||||          :..|||||     |......|..||.:|:...||:|
Human   128 VHFQAGRFHLDGSRESFDC----------LFELLEHY-----VAAPRRMLGAPLRQRRVRPLQEL 177

  Fly   581 SRATIVSNTSYDGINQMELPGRLKSYLKEYHYK 613
            .|..||:....:.:.::.|...|:.||..:.::
Human   178 CRQRIVATVGRENLARIPLNPVLRDYLSSFPFQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 32/113 (28%)
SOCS 575..626 CDD:295349 10/39 (26%)
SOCS1NP_003736.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 15/39 (38%)
Kinase inhibitory region (KIR) 55..66 3/20 (15%)
Extended SH2 subdomain (ESS) 67..78 3/10 (30%)
SH2_SOCS1 68..165 CDD:198245 31/111 (28%)
SOCS_SOCS1 169..211 CDD:239704 11/42 (26%)
Interaction with Elongin BC complex. /evidence=ECO:0000250 173..182 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.