DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and SLA2

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_016883587.1 Gene:SLA2 / 84174 HGNCID:17329 Length:288 Species:Homo sapiens


Alignment Length:178 Identity:46/178 - (25%)
Similarity:69/178 - (38%) Gaps:50/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 PAP--------QSPQTPPRPRPLATVA-----PAGGAGHAGIGAARNM----------TVHSQID 457
            |:|        |.|.|....|..||..     ||||.....:.....:          ||.|::.
Human    12 PSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVS 76

  Fly   458 FMHCLVPDLE--KITNSSFYWGKMDRYEAEH--LLEGKPEGTFLLRDSAQEEFLFSVTFR----- 513
            .....:|.:.  |:::...|.| :.|.:||.  ||.|.|.|.||:|:|......:|::.|     
Human    77 GREYNIPSVHVAKVSHGWLYEG-LSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPA 140

  Fly   514 KYGRSLHARIEQSGHKFSFDCHD-------PCVFTAPTVTGLLEHYKD 554
            .:.|..|.||.         |.|       |.: |.|::..|::||.|
Human   141 SWDRIRHYRIH---------CLDNGWLYISPRL-TFPSLQALVDHYSD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 31/108 (29%)
SOCS 575..626 CDD:295349
SLA2XP_016883587.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.