DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and Cish

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_113992.1 Gene:Cish / 83681 RGDID:69261 Length:257 Species:Rattus norvegicus


Alignment Length:254 Identity:63/254 - (24%)
Similarity:97/254 - (38%) Gaps:65/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 PGFVVES-PNGGRVTVVTEPAPQSPQTPPRPRPLATVAPAGGAGHAGIGAARNMTVHSQIDFMHC 461
            ||..::. |.|.....|||..|...:..|:     .:.|.|                   |.: |
  Rat    30 PGPAMQPLPTGAFPEEVTEETPVQSENEPK-----VLDPEG-------------------DLL-C 69

  Fly   462 LVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARIEQS 526
            :......:..|.:|||.:...||...|:..||||||:|||....:||:::.:......:.|||.:
  Rat    70 IAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYA 134

  Fly   527 GHKFSFDCH---DPCVFTAPTVTGLLEHY------------KDPACVMFF---------EPCLTI 567
            ...|..|.:   .|.:...|.|..|::||            .|||.....         :|.|.|
  Rat   135 DSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPVPKPDAPGDPVLPI 199

  Fly   568 P-------------LHRRQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYK 613
            |             :.|....|||.|.|  :|.|.....::.:.||.|:..||::|.::
  Rat   200 PVATAVHLKLVQPFVRRSSARSLQHLCR--LVINRLVTDVDCLPLPRRMADYLRQYPFQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 32/123 (26%)
SOCS 575..626 CDD:295349 13/39 (33%)
CishNP_113992.1 SH2_CIS 77..164 CDD:198285 28/86 (33%)
SOCS_CIS1 217..257 CDD:239703 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.