DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and cish

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001070085.1 Gene:cish / 767678 ZFINID:ZDB-GENE-050907-1 Length:212 Species:Danio rerio


Alignment Length:231 Identity:60/231 - (25%)
Similarity:99/231 - (42%) Gaps:48/231 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 VTVVTEPAPQS--PQTPPR--PRPLATVAPAGGAGHAGIGAARNMTVHSQIDFMHCLVPDLEKIT 470
            :..|..|:|::  |.:.||  ..|..|:..|..                  |: ..|..:...:.
Zfish     2 ILCVEGPSPRALLPFSSPRRIDEPFLTIEDASK------------------DY-RALTLNFSYLD 47

  Fly   471 NSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARIEQSGHKFSFDCH 535
            .|.:|||.:...||..:|:|..|||||:|||:..:::.:::.:......:.|||....:||.|..
Zfish    48 ASGWYWGGISASEAHSVLKGASEGTFLIRDSSHPDYMLTLSVKTVRGPTNVRIEYRQCRFSLDSS 112

  Fly   536 DPC---VFTAPTVTGLLEHY------------KDPACVMFFEP--C-----LTIPLHRRQTF-SL 577
            .|.   :.:.|.|..|::||            ::...|:...|  |     |..|:|..|.| ||
Zfish   113 SPARSHLQSFPDVHSLVQHYVGSKSEKNEEKMEEAHHVISSAPKECSVLLKLKKPIHCPQGFPSL 177

  Fly   578 QQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYK 613
            :.|:|..|..:||  ....:.||..|..||:.|.::
Zfish   178 KHLTRLVINKHTS--STEMLPLPNPLLYYLQNYPFQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 29/114 (25%)
SOCS 575..626 CDD:295349 14/40 (35%)
cishNP_001070085.1 SH2_CIS 46..133 CDD:198285 27/86 (31%)
SOCS 175..212 CDD:295349 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.