DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and Sla2

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001165589.1 Gene:Sla2 / 499931 RGDID:1562071 Length:263 Species:Rattus norvegicus


Alignment Length:325 Identity:71/325 - (21%)
Similarity:118/325 - (36%) Gaps:114/325 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 RGLRDMLPSSSSSVSNK-KDAAAVVAMVPRKSRTADRRSTPPTLGTSSGGSQRRMQSQRIRNSVA 380
            || ::..||||||.|.. ::..::.|...:.|..|        ||:...|.|.|           
  Rat     8 RG-KNSSPSSSSSFSGPGQEPVSIQAERQKVSAVA--------LGSFPAGEQAR----------- 52

  Fly   381 VPDASHHHHQLIIRITSPGFVVESPNGGRVTVVTEPAPQSPQTPPRPRPLATVAPAGGAGHAGIG 445
                      |.:|:..|           :|:::|....                          
  Rat    53 ----------LSLRVGEP-----------LTIISEDGDW-------------------------- 70

  Fly   446 AARNMTVHSQIDFMHCLVPD--LEKITNSSFYWGKMDRYEAEH--LLEGKPEGTFLLRDSAQEEF 506
                .||.|::......:|.  :.|:::...|.| :.|.:||.  ||.|.|.|.||:|:|.....
  Rat    71 ----WTVQSEVSGREYHIPSVYVAKVSHGWLYEG-LSREKAEELLLLPGNPGGAFLIRESQTRRG 130

  Fly   507 LFSVTFR-----KYGRSLHARIEQSGHKFSFDCHDPCVFTAPTVTGLLEHYK---DPACVMFFEP 563
            .:|::.|     .:.|..|.||::..:.:.:  ..|.: |.|::..|:|||.   |..|....||
  Rat   131 CYSLSIRLSRPASWDRIRHYRIQRLDNGWLY--ISPRL-TFPSLHALVEHYSELADGICCALREP 192

  Fly   564 C----------------LTIPLHRRQTFSL--QQLSRATIVSNTSYDGINQMELPG---RLKSYL 607
            |                :|:|     |.||  ::|.|:.:..:....|...:...|   .|.||:
  Rat   193 CVLQKLGPLPGKDTPLPVTVP-----TSSLNWKKLDRSLLCLDAPASGEASLLSEGLRESLSSYI 252

  Fly   608  607
              Rat   253  252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 31/111 (28%)
SOCS 575..626 CDD:295349 9/38 (24%)
Sla2NP_001165589.1 SH3 39..92 CDD:302595 15/122 (12%)
SH2_SLAP 85..187 CDD:198207 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.