DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and socs3

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001005696.1 Gene:socs3 / 448204 XenbaseID:XB-GENE-488199 Length:199 Species:Xenopus tropicalis


Alignment Length:195 Identity:50/195 - (25%)
Similarity:80/195 - (41%) Gaps:50/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 RNMTVHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTF 512
            |..|..|:.:: :.::..:.|:..|.|||..:...:|..||..:|.||||:|||:.....|:::.
 Frog    19 RLKTFSSRSEY-NLVLTAVRKLQESGFYWSTVTGSQANLLLSTEPAGTFLIRDSSDRRHFFTLSV 82

  Fly   513 RKYGRSLHARIEQSGHKFSFDCHDPCVFTAPT-------------VTGLLEHY---KDPAC---- 557
            :....:.:.||:         | :||.|:..|             |..||.||   ||...    
 Frog    83 KTESGTKNLRIQ---------C-EPCGFSLQTDPRSAQPVPRFDCVLKLLCHYMPAKDSGSGSKR 137

  Fly   558 ------------VMFFEPCLTIPLHRRQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEY 610
                        ::...|..|      ...|||.|.|.. |:.|...|..:.:||..:|.:|:||
 Frog   138 AYYIYSGGERVPLLLSRPLST------SVSSLQHLCRKA-VNGTIEGGEGREQLPLPIKDFLQEY 195

  Fly   611  610
             Frog   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 31/131 (24%)
SOCS 575..626 CDD:295349 14/36 (39%)
socs3NP_001005696.1 SH2_SOCS3 33..133 CDD:198247 31/109 (28%)
SOCS 158..199 CDD:383010 15/45 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.