Sequence 1: | NP_523593.5 | Gene: | Socs36E / 35085 | FlyBaseID: | FBgn0041184 | Length: | 737 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005696.1 | Gene: | socs3 / 448204 | XenbaseID: | XB-GENE-488199 | Length: | 199 | Species: | Xenopus tropicalis |
Alignment Length: | 195 | Identity: | 50/195 - (25%) |
---|---|---|---|
Similarity: | 80/195 - (41%) | Gaps: | 50/195 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 448 RNMTVHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTF 512
Fly 513 RKYGRSLHARIEQSGHKFSFDCHDPCVFTAPT-------------VTGLLEHY---KDPAC---- 557
Fly 558 ------------VMFFEPCLTIPLHRRQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEY 610
Fly 611 610 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Socs36E | NP_523593.5 | SH2 | 463..563 | CDD:301589 | 31/131 (24%) |
SOCS | 575..626 | CDD:295349 | 14/36 (39%) | ||
socs3 | NP_001005696.1 | SH2_SOCS3 | 33..133 | CDD:198247 | 31/109 (28%) |
SOCS | 158..199 | CDD:383010 | 15/45 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |