DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and socs3l

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_988992.1 Gene:socs3l / 394588 XenbaseID:XB-GENE-5809273 Length:211 Species:Xenopus tropicalis


Alignment Length:162 Identity:50/162 - (30%)
Similarity:72/162 - (44%) Gaps:35/162 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 LEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARIEQSGHKF 530
            ||::..|.:||..:...||:.||..:|.|:||:|||:....||:::.|......:.||:..|..|
 Frog    47 LERLEASGYYWSTLSGTEAKKLLSDQPVGSFLIRDSSDHHHLFTLSLRTSAGITNLRIKLEGPSF 111

  Fly   531 SFD----CHDPCVFTAPTVTGLLEHY-------------------KDPACVMFFEPCLTIPLHRR 572
            ..:    ...|..|  |.|..|:|||                   ..|..:|     ||.||:.:
 Frog   112 YLETVAGAESPHTF--PCVVKLVEHYMRLTAAGESDSNLCYIEGNDQPVPLM-----LTQPLNCK 169

  Fly   573 QTFSLQQLSRATIVSN----TSYDGINQMELP 600
             ..|||.|.:.|:|:|    .|..|.|..|||
 Frog   170 -VVSLQYLCKRTVVANMPAEASSSGENMEELP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 33/119 (28%)
SOCS 575..626 CDD:295349 13/30 (43%)
socs3lNP_988992.1 SH2_SOCS3 44..143 CDD:198247 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.