DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and socs3a

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_956244.1 Gene:socs3a / 335409 ZFINID:ZDB-GENE-030131-7349 Length:207 Species:Danio rerio


Alignment Length:188 Identity:51/188 - (27%)
Similarity:79/188 - (42%) Gaps:41/188 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 TVHSQIDFMHCLVP-DLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRK 514
            |..|::.|.  ||. .:..:..|.||||.:...||.|||..:|.||||:|||:.....|:::.:.
Zfish    29 TFSSKVQFQ--LVQHTIRMLQESGFYWGAISGKEANHLLSSEPSGTFLVRDSSDNRHFFTLSVKT 91

  Fly   515 YGRSLHARIEQSGHKF-------------SFDCHDPCVFTAPTVTGLLEHYKDPACVMFFEPCLT 566
            ...:.:.|::.....|             .|||          |..|::||...:.:....|..:
Zfish    92 ESGTKNLRVQCDNKSFFLQTDSKSMQSVPRFDC----------VLRLVQHYMPRSALSIGIPRSS 146

  Fly   567 ---------IPLHRRQTF-----SLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEY 610
                     |||...:..     |||.|.|.|:..:|.... .:..||.:||.:|:||
Zfish   147 YYIYTGGEKIPLELLRPLQCSMSSLQHLCRKTVNGHTDVSS-KREHLPQQLKDFLQEY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 29/113 (26%)
SOCS 575..626 CDD:295349 14/41 (34%)
socs3aNP_956244.1 SH2_SOCS3 40..139 CDD:198247 28/108 (26%)
SOCS 167..207 CDD:295349 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575812
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.