DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and Socs1

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_665886.2 Gene:Socs1 / 252971 RGDID:69272 Length:212 Species:Rattus norvegicus


Alignment Length:253 Identity:70/253 - (27%)
Similarity:99/253 - (39%) Gaps:60/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 RNSVAVPDASHHHHQLIIRITSPGFVVESPNGGRVTVVTEPAPQSPQTPPRPRPLATV-APAGGA 439
            ||.||..:|           .||.    |....|....:..:..||..|.||||...| |||.|.
  Rat     4 RNQVAADNA-----------ISPA----SEPRRRPEPSSSSSSSSPAAPARPRPCPVVPAPAPGD 53

  Fly   440 GHAGIGAARNMTVHSQIDFMHCLVPDLEKITNSS-------FYWGKMDRYEAEHLLEGKPEGTFL 497
            .|     .|....||          |..:||.:|       ||||.:..:.|...|..:|.||||
  Rat    54 TH-----FRTFRSHS----------DYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFL 103

  Fly   498 LRDSAQEEFLFSVTFRKYGRSLHARIEQSGHKF-------SFDCHDPCVFTAPTVTGLLEHYKDP 555
            :|||.|....|:::.:........|:.....:|       :|||          :..|||||   
  Rat   104 VRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRETFDC----------LFELLEHY--- 155

  Fly   556 ACVMFFEPCLTIPLHRRQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYK 613
              |......|..||.:|:...||:|.|..||:....:.:.::.|...|:.||..:.::
  Rat   156 --VAAPRRMLGAPLRQRRVRPLQELCRQRIVAAVGRENLARIPLNPVLRDYLSSFPFQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 31/113 (27%)
SOCS 575..626 CDD:295349 10/39 (26%)
Socs1NP_665886.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 22/72 (31%)
Kinase inhibitory region (KIR) 56..67 4/20 (20%)
Extended SH2 subdomain (ESS) 68..79 3/10 (30%)
SH2_SOCS1 69..166 CDD:198245 30/111 (27%)
SOCS 170..212 CDD:413360 11/42 (26%)
Interaction with Elongin BC complex. /evidence=ECO:0000250 174..183 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.