DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and CISH

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_037456.5 Gene:CISH / 1154 HGNCID:1984 Length:275 Species:Homo sapiens


Alignment Length:258 Identity:64/258 - (24%)
Similarity:96/258 - (37%) Gaps:70/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 TP-PRPRPLATV----------------------APAG------GAGHAGIGAARNMTVHSQIDF 458
            || ||||||..|                      .|||      ..|......:....:..:.|.
Human    20 TPLPRPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDL 84

  Fly   459 MHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARI 523
            : |:......:..|.:|||.:...||...|:..||||||:|||....:||:::.:......:.||
Human    85 L-CIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRI 148

  Fly   524 EQSGHKFSFDCH---DPCVFTAPTVTGLLEHY------------KDPACVMFF---------EPC 564
            |.:...|..|.:   .|.:...|.|..|::||            .|||.....         :|.
Human   149 EYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPA 213

  Fly   565 LTIP--------------LHRRQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYK 613
            |..|              :.|....|||.|.|  :|.|.....::.:.||.|:..||::|.::
Human   214 LPAPPPATAVHLKLVQPFVRRSSARSLQHLCR--LVINRLVADVDCLPLPRRMADYLRQYPFQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 32/123 (26%)
SOCS 575..626 CDD:295349 13/39 (33%)
CISHNP_037456.5 SH2_CIS 94..181 CDD:198285 28/86 (33%)
SOCS_CIS1 235..275 CDD:239703 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142953
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.