DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and cishb

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_017213670.1 Gene:cishb / 100136861 ZFINID:ZDB-GENE-080204-120 Length:213 Species:Danio rerio


Alignment Length:180 Identity:55/180 - (30%)
Similarity:84/180 - (46%) Gaps:30/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 DFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHA 521
            || |.:....:.:..|.:|||.:...:|...|.|.||||||:|||:...:||:::.:.:....:.
Zfish    40 DF-HFITTTFQHLNTSGWYWGGLTAGDARAALIGAPEGTFLVRDSSHPLYLFTLSVQTWRGPTNI 103

  Fly   522 RIEQSGHKFSFDCHDP---CVFTAPTVTGLLEHY-------------------KDPACVMFFEPC 564
            |||....:|..|...|   |:.:...:..|:.||                   ||...::    .
Zfish   104 RIEYDSGRFRLDSSFPARSCLLSFSALPSLVHHYSSARPEEEKKAEDHHHMVAKDTGILL----K 164

  Fly   565 LTIPLHRRQTF-SLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYK 613
            |..||||.|.| :||.|:|.||  |...|...::.||..|..||:||.::
Zfish   165 LRKPLHRPQAFPTLQHLTRLTI--NRHTDCHTKLPLPRPLLLYLQEYPFQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 30/121 (25%)
SOCS 575..626 CDD:295349 16/40 (40%)
cishbXP_017213670.1 SH2_CIS 51..138 CDD:198285 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.