DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs36E and socs1b

DIOPT Version :9

Sequence 1:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001239559.1 Gene:socs1b / 100007521 ZFINID:ZDB-GENE-090313-141 Length:193 Species:Danio rerio


Alignment Length:208 Identity:55/208 - (26%)
Similarity:85/208 - (40%) Gaps:47/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 APQSPQTPPRPRPLATVAPAGGAGHAGIGAARNMTVHSQIDFMHCLVPDLEK-----ITNSSFYW 476
            ||.....||:|   .:|.|.    |          .|...|...|   :|.|     :|:|.|||
Zfish    19 APPKSAEPPKP---CSVPPT----H----------FHPFRDQQEC---NLIKQAVVYLTHSGFYW 63

  Fly   477 GKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARI-------EQSGHKFSFDC 534
            |.:|..||...|...|.||||:|||.|....|::::|........|:       ..:|.|.:|.|
Zfish    64 GPLDVDEAHARLANLPLGTFLIRDSMQANVFFTLSYRAPEGPTSVRVLLKNESFSLAGSKHTFSC 128

  Fly   535 HDPCVFTAPTVTGLLEHYKDPACVMFFEPCLTIPLHRRQTFSLQQLSRATIVSNTSYDGINQMEL 599
                      :.|||.:|     :...:..|:.|.......:||:|:|..:|.:...|.|..:.:
Zfish   129 ----------IFGLLGYY-----IASPKKSLSRPYRGDVPQTLQELARRAVVQSFGKDSIPHLPV 178

  Fly   600 PGRLKSYLKEYHY 612
            ..:||.::..|.:
Zfish   179 SKKLKEFIWLYPF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs36ENP_523593.5 SH2 463..563 CDD:301589 32/111 (29%)
SOCS 575..626 CDD:295349 10/38 (26%)
socs1bNP_001239559.1 SH2_SOCS1 50..147 CDD:198245 32/111 (29%)
SOCS 153..186 CDD:295349 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575809
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.