DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kel and Kbtbd8

DIOPT Version :9

Sequence 1:NP_476589.4 Gene:kel / 35084 FlyBaseID:FBgn0001301 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001102720.2 Gene:Kbtbd8 / 500262 RGDID:1563166 Length:601 Species:Rattus norvegicus


Alignment Length:560 Identity:145/560 - (25%)
Similarity:242/560 - (43%) Gaps:89/560 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ASQNSLDESSQKHVQRPNG-KERGTVGQYSNEQHTARSFDAMNEMRKQKQLCDVILVADDVE-IH 169
            |:...|.:||    ..||| ....|.....:..|.......:..|..:.||.|:::..|..: ..
  Rat     2 AASADLSKSS----PTPNGIPSSDTANDTMDPFHACSILKQLKTMYDEGQLTDIVVEVDHGKTFS 62

  Fly   170 AHRMVLASCSPYFYAMFTS-FEESRQARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTAA 233
            .||.|||:.||||.:|||| ..||.|..:.:..|:|.::.|:::|.||:.|.:.|.|||.|.|.|
  Rat    63 CHRNVLAAISPYFRSMFTSGLTESTQKEVRIIGVEAESMGLVLNYAYTSRVILTEANVQALFTTA 127

  Fly   234 NLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLNLS 298
            ::.|:..::|.|..::.:.||..|.:|:..|||.:...||.:.::.||.:.|..|.:..|||.|:
  Rat   128 SIFQIPSIQDQCAKYMISHLDPQNSIGVFIFADHYGHQELGDRSKEYIRKKFLCVTKEQEFLQLT 192

  Fly   299 HEQVISLIGNDRISVPNEERVYECVIAWLRYDVPMRE-QFTSLLMEHVRLPFLSKEYI------- 355
            .:|:||::.:|.::|..||.|||.:|.|..::...|| ....:..:.:|.|.:...:|       
  Rat   193 KDQLISILDSDDLNVDREEHVYESIIRWFEHEQNEREVHLPEIFAKCIRFPLMEDAFIEKIPPRF 257

  Fly   356 TQRVDKEILLEGNIVCKNLIIEALTYHLLPTETKSARTVPRKPVGMPKILLVI--------GGQA 412
            .|.:.|....:|                 |:.|...    .:.:||....::|        .|:.
  Rat   258 AQAIVKSCGEKG-----------------PSNTNGC----TQRLGMTASEMIICFDAAHKHSGKK 301

  Fly   413 PKAIRSVEWYDLREEKWYQAAEMPNRRCRSGLSVLGDK-VYAVGGFNGSLRVRTVD--------V 468
                ::|...|:...:.::..:.||.....|:.|..|. :|..||:..|....::|        :
  Rat   302 ----QTVPCLDIVTGRVFKLCKPPNDLREVGILVSPDNDIYIAGGYRPSSSEVSIDHKAENDFWM 362

  Fly   469 YDPATDQWANCSNMEARRSTLGVAVLNGC--IYAVGG----FDGTTGLSSAEMYDPKTDIWRFIA 527
            ||.:|::|  .|.....|:.:|..::..|  :||:||    .||...|.|.|.||.:.:.|..:.
  Rat   363 YDHSTNRW--LSKPSLLRARIGCKLVYCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENCWMTVC 425

  Fly   528 SM-------STRRSSVGVGVVHGLLYAVGGYDGFTRQCLSSVERYNPDTDTWVNVAEMSSRRSGA 585
            :|       :.......:.|:.|..:..                |.|..|.|..:..|:..|...
  Rat   426 AMPVAMEFHNAVEHKEKIYVLQGEFFLF----------------YEPQKDYWGFLTPMTVPRIQG 474

  Fly   586 GVGVLNNILYAVGGHDGPMVR-RSVEAYDCETNSWRSVAD 624
            ...|..:.:|.:.|..|...| .:|||||.|.|.|....|
  Rat   475 LAAVYKDSIYYIAGTCGNHQRVFTVEAYDIELNKWTRKKD 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kelNP_476589.4 BTB 147..250 CDD:279045 38/104 (37%)
PHA03098 150..675 CDD:222983 136/516 (26%)
BACK 258..359 CDD:285009 32/108 (30%)
Kelch 405..449 CDD:128874 8/51 (16%)
KELCH repeat 439..482 CDD:276965 13/51 (25%)
Kelch 450..496 CDD:128874 12/54 (22%)
KELCH repeat 486..530 CDD:276965 16/56 (29%)
Kelch 497..543 CDD:128874 15/58 (26%)
KELCH repeat 533..580 CDD:276965 7/46 (15%)
Kelch 544..592 CDD:128874 7/47 (15%)
KELCH repeat 582..626 CDD:276965 15/44 (34%)
Kelch 594..639 CDD:128874 13/32 (41%)
KELCH repeat 629..674 CDD:276965
Kelch 640..687 CDD:128874
Kbtbd8NP_001102720.2 BTB 39..144 CDD:279045 38/104 (37%)
PHA03098 50..516 CDD:222983 133/508 (26%)
BACK 153..250 CDD:285009 30/96 (31%)
KELCH repeat 330..376 CDD:276965 12/47 (26%)
Kelch 337..388 CDD:128874 12/52 (23%)
Kelch_1 379..428 CDD:279660 14/48 (29%)
KELCH repeat 380..428 CDD:276965 14/47 (30%)
KELCH repeat 431..467 CDD:276965 6/51 (12%)
Kelch_1 470..516 CDD:279660 15/45 (33%)
KELCH repeat 519..571 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4441
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.