DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kel and W07A12.4

DIOPT Version :9

Sequence 1:NP_476589.4 Gene:kel / 35084 FlyBaseID:FBgn0001301 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001343736.1 Gene:W07A12.4 / 174454 WormBaseID:WBGene00012322 Length:528 Species:Caenorhabditis elegans


Alignment Length:242 Identity:46/242 - (19%)
Similarity:107/242 - (44%) Gaps:29/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 MNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTSFEESRQARITLQSVD----ARAL 207
            |.:.....|..||.:...:....|||::|:..|..|..|.:  ::....:..|:.|:    .:|.
 Worm   115 MAKFYNNAQFSDVNMKVGEESYPAHRLILSKSSDVFDRMMS--QKWNGDKFDLELVEDELCQKAF 177

  Fly   208 ELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVE 272
            ...:.::|:..|.:::||...||..|:...:|.::..|.||.|:::  ...:.::|...:.....
 Worm   178 APFLRFMYSNHVVLHKDNCLPLLVLADKYNVTTLKKVCLDFAQSEI--LPVIDLKELFSVWFSYA 240

  Fly   273 LLNYAETYIEQHFNEV-IQFDEFL---------NLSHEQVISLIGNDRISVPNEERVYECVIAWL 327
            ...|..:.|:.....: ::|:..|         .|..:|:|.::..:.:.|.:|.:::|.:..|:
 Worm   241 TKAYHPSLIKSCMQAIALEFETLLTEEWEKDWQELHRDQMIEILKCNNLKVASEFKLWEALQKWI 305

  Fly   328 RYDVPMREQ--------FTSLLMEHVRLPFLSKEYITQRVDKEILLE 366
            :  .|...:        ..:.|:..:|.||::.:.:.: |:|..:.|
 Worm   306 Q--APNHSERRGNTAGPLLAFLLPLIRFPFMNGDELNE-VEKSAISE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kelNP_476589.4 BTB 147..250 CDD:279045 25/106 (24%)
PHA03098 150..675 CDD:222983 45/239 (19%)
BACK 258..359 CDD:285009 17/118 (14%)
Kelch 405..449 CDD:128874
KELCH repeat 439..482 CDD:276965
Kelch 450..496 CDD:128874
KELCH repeat 486..530 CDD:276965
Kelch 497..543 CDD:128874
KELCH repeat 533..580 CDD:276965
Kelch 544..592 CDD:128874
KELCH repeat 582..626 CDD:276965
Kelch 594..639 CDD:128874
KELCH repeat 629..674 CDD:276965
Kelch 640..687 CDD:128874
W07A12.4NP_001343736.1 BTB_POZ_BTBD17 108..219 CDD:349601 24/105 (23%)
BACK 236..342 CDD:197943 16/108 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.