DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kel and Btbd18

DIOPT Version :9

Sequence 1:NP_476589.4 Gene:kel / 35084 FlyBaseID:FBgn0001301 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_002729248.1 Gene:Btbd18 / 100363270 RGDID:2323370 Length:724 Species:Rattus norvegicus


Alignment Length:110 Identity:28/110 - (25%)
Similarity:61/110 - (55%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 YSNEQHTARSFDAMNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTSFE--ESRQAR 196
            |.|.:....:|..::..::....||.:|.|:...:.||..:|::|||:|........  :.|:..
  Rat    11 YRNPRFLRVAFLQLHHQQQSGVFCDALLQAEGEAVPAHCCILSACSPFFTERLERERPVQGRKVV 75

  Fly   197 ITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDV 241
            :.|..:..:.|..|:|::||:.:||:::..|.:|:||..|:::::
  Rat    76 LELGGLKIQTLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRVSEL 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kelNP_476589.4 BTB 147..250 CDD:279045 25/97 (26%)
PHA03098 150..675 CDD:222983 25/94 (27%)
BACK 258..359 CDD:285009
Kelch 405..449 CDD:128874
KELCH repeat 439..482 CDD:276965
Kelch 450..496 CDD:128874
KELCH repeat 486..530 CDD:276965
Kelch 497..543 CDD:128874
KELCH repeat 533..580 CDD:276965
Kelch 544..592 CDD:128874
KELCH repeat 582..626 CDD:276965
Kelch 594..639 CDD:128874
KELCH repeat 629..674 CDD:276965
Kelch 640..687 CDD:128874
Btbd18XP_002729248.1 BTB 24..123 CDD:279045 25/97 (26%)
BTB 35..123 CDD:197585 24/86 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.