DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5758 and postna

DIOPT Version :9

Sequence 1:NP_001286028.1 Gene:CG5758 / 35083 FlyBaseID:FBgn0032666 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_002663594.2 Gene:postna / 378983 ZFINID:ZDB-GENE-091113-23 Length:1016 Species:Danio rerio


Alignment Length:317 Identity:71/317 - (22%)
Similarity:136/317 - (42%) Gaps:55/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KVFQHFLSKSNL-TRIMDDNAYTVLIPSDNAFQRWHPIDWGFYPFS---VPEFTESVLRN--HFL 318
            |..|.:..:|.| ..|..:.:||:..|||:|   |..:|    |.|   |.....:.|.|  |:.
Zfish   111 KTTQQYADQSKLREEIAGEGSYTIFAPSDDA---WEELD----PASKAAVISLGNTELYNALHYH 168

  Fly   319 PMQRPLRLADVRNMDEVVVTTM---GGEDVVFHGQPTPTVNNVSIMSDYNLSNGNQVFIISEVLF 380
            .:.:.....|::|  ::.:.:|   .|..:..:.....|||...|:      :|||| ..:.|:.
Zfish   169 MVSKRFLTKDLKN--DMTLESMFNKQGLHINHYSNGVVTVNCARII------HGNQV-ATNGVVH 224

  Fly   381 VTEAVVSKLHQMHKDKETPPLLAFPWFGAQFLSHSFLALERDPRFTQITRYLNSAEIAPHI-SGA 444
            |.:.|:|.:.|..||                      .:|.:...:.::..:.||::...: ...
Zfish   225 VIDRVISVVSQTIKD----------------------VIETNDDLSSLSGVVVSADLQDQLGEPG 267

  Fly   445 NYTFFVPEDRAFEKQGFDKLSDEVMASQRGVKMLLN-HFVKGRLYNRDLRDNEVFETIGGGHIKI 508
            :||.|.|.:.||:|...|.| :.:|:.|..::.||. |.:.....:..:....::.|:.|.:|:|
Zfish   268 HYTLFAPTNEAFDKINADAL-ERLMSDQTVIQALLKYHLLNSVQCSEAIMAGSIYGTLEGSNIEI 331

  Fly   509 TRNPGSNYTSVNNAQITESEVFVYNLGTMYYLDDILY---SHMLRDFVSKSTKTRSN 562
            ..: |.:.| ||..::...:..|.:.|.::.:|.:|.   :..:.:.|.||....|:
Zfish   332 GCD-GESLT-VNGIKMVLKKDIVTSNGVIHLIDQVLMPDSAKQVMELVGKSQSVFSD 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5758NP_001286028.1 FAS1 281..380 CDD:214719 26/106 (25%)
FAS1 447..545 CDD:214719 24/98 (24%)
postnaXP_002663594.2 Fasciclin 111..230 CDD:280607 33/134 (25%)
Fasciclin 245..367 CDD:280607 28/124 (23%)
Fasciclin 382..492 CDD:280607 1/5 (20%)
FAS1 461..635 CDD:225214
Fasciclin 507..630 CDD:280607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10900
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.