DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5758 and Postn

DIOPT Version :9

Sequence 1:NP_001286028.1 Gene:CG5758 / 35083 FlyBaseID:FBgn0032666 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_006232397.1 Gene:Postn / 361945 RGDID:1305285 Length:838 Species:Rattus norvegicus


Alignment Length:415 Identity:80/415 - (19%)
Similarity:153/415 - (36%) Gaps:103/415 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 GHKIVFRKLEKSHNNVWLLNGQQILHKLRINENLMAIAI----DG---YLGDRKSPYSKRNIQET 214
            |.|:....|.|.|          ||:.|:.:|.:...|:    :|   .:|......|...|:..
  Rat   294 GDKVASEALMKYH----------ILNTLQCSEAITGGAVFETMEGNTIEIGCEGDSISINGIKMV 348

  Fly   215 NNRYNDPQPLEQPNITNAHA---KVEPVIKESKASPLMSFLANMKTGTKVFQHFLSKSNL-TRIM 275
            |.:          :|...:.   .::.|:....|..::......:|   .|...:::..| :.:.
  Rat   349 NKK----------DIVTKNGVIHLIDEVLIPDSAKQVIELAGKQQT---TFTDLVAQLGLASSLK 400

  Fly   276 DDNAYTVLIPSDNAF--------QRWHPIDWGFYPFSVPEFTESVLRNHFLPMQRPLRLADVRNM 332
            .|..||:|.|.:|||        ||               ..:.:|:||.|.::  :.|:|:.|.
  Rat   401 PDGEYTLLAPVNNAFSDDTLSMDQR---------------LLKLILQNHILKVK--VGLSDLYNG 448

  Fly   333 DEVVVTTMGGEDV-VFHGQPTPTVNNVSIMSDYNLSNGNQVFIISEVLFVTEAVVSKLHQMHKDK 396
            .  ::.|:||:.: ||..:....:.|..::..........:.|..|::...|   ..||:     
  Rat   449 Q--ILETIGGKQLRVFVYRTAICIENSCMVRGSKQGRNGAIHIFREIIQPAE---KSLHE----- 503

  Fly   397 ETPPLLAFPWFGAQFLSHSFLALERDPRFTQITRYLNSAEIAPHIS-GANYTFFVPEDRAFEKQG 460
                                 .|.:|.||:.....|.:|::...:: ..::|.|.|.:.||  :|
  Rat   504 ---------------------KLRQDKRFSIFLSLLEAADLKDLLTQPGDWTLFAPTNDAF--KG 545

  Fly   461 FDKLSDEVMASQRGV--KMLLNHFVKGRLYNRDLRD--NEVFETIGGGHIKITRNPGSNYT-SVN 520
            ......|::...:..  .::|.|...|....:....  ..:.:|..|..|.:   .|.|.| .||
  Rat   546 MTNEEREILIGDKNALQNIILYHLTPGVYIGKGFEPGVTNILKTTQGSKIYV---KGVNETLLVN 607

  Fly   521 NAQITESEVFVYNLGTMYYLDDILY 545
            ..:..||::...| |.::.:|.:||
  Rat   608 ELKSKESDIMTTN-GVIHVVDKLLY 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5758NP_001286028.1 FAS1 281..380 CDD:214719 23/107 (21%)
FAS1 447..545 CDD:214719 23/102 (23%)
PostnXP_006232397.1 Fasciclin 111..232 CDD:396845
Fasciclin 247..369 CDD:396845 17/94 (18%)
Fasciclin 384..496 CDD:396845 28/133 (21%)
Fasciclin 509..632 CDD:396845 29/129 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10900
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.