DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5758 and SPAC22H12.05c

DIOPT Version :9

Sequence 1:NP_001286028.1 Gene:CG5758 / 35083 FlyBaseID:FBgn0032666 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_593117.1 Gene:SPAC22H12.05c / 2541828 PomBaseID:SPAC22H12.05c Length:728 Species:Schizosaccharomyces pombe


Alignment Length:331 Identity:60/331 - (18%)
Similarity:121/331 - (36%) Gaps:76/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ITNAHAKVEPVIKESKASPLMSFLANMKTGTKVFQHFLSKSNLTRIMDDN-AYTVLIPSDNAFQR 292
            |:.|:.|.|   .|.|::.::..|::....:|:.:. |.::.|...::.| ..|:..|.:.||  
pombe    16 ISFANGKNE---YEDKSTSIIDLLSSKSQFSKLIRR-LQRNRLVPYLNRNKGLTLFAPLNEAF-- 74

  Fly   293 WHPID-----WGFYPFSVPEFTESVLRNHFLPMQRPLRLADVRNMDEVVVTTMGGEDVVFH---- 348
              |.|     ..:|..:..|...||||..       |:.:|             |:.:...    
pombe    75 --PDDSIEPNLLYYIVNTTELDRSVLRTQ-------LKSSD-------------GQQIALKIHYK 117

  Fly   349 ---GQPTPTVNNVSIMSDYNLSNGNQVFIISEVLFVTEAVVSKLHQMHKDKETPPLLAFPWFGAQ 410
               |:....|||..|:.....::...|.:|..::.:....:..| ...||......|:..|.| :
pombe   118 AETGRAYDKVNNAQIVQSNWRADSGVVQVIDNIIDLPPPALEIL-SSEKDFSIFHRLSVAWVG-E 180

  Fly   411 FLSHSFLALERDPRFTQITRYLNSAEIAPHISGANYTFFVPEDRAFEKQGFDKLSDEVMASQRGV 475
            :.|.:.|.    |..:.......:.|:|     ..|:.:..||                     |
pombe   181 YSSVTMLV----PDSSAFLNVYTNTELA-----YLYSMYAAED---------------------V 215

  Fly   476 KMLLNH--FVKGRLYNRDLRDNEVFETIGGGHIKITRNPGSNYTSVNNAQITESEVFVYNLGTMY 538
            |.|::.  .|..|:|..|:.:.:.|....|..|.:..:.......:|:...|:.::..:: |.::
pombe   216 KTLIHQHILVNQRVYAEDVIEPKTFHYKNGISISMKFDKDQKKLFINDVSTTKYDLLTFS-GAIH 279

  Fly   539 YLDDIL 544
            .:..::
pombe   280 TVSSLI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5758NP_001286028.1 FAS1 281..380 CDD:214719 22/110 (20%)
FAS1 447..545 CDD:214719 15/100 (15%)
SPAC22H12.05cNP_593117.1 Fasciclin 40..151 CDD:280607 26/135 (19%)
FAS1 78..422 CDD:225214 43/261 (16%)
Fasciclin 179..287 CDD:295423 22/139 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10900
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.