DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5758 and POSTN

DIOPT Version :9

Sequence 1:NP_001286028.1 Gene:CG5758 / 35083 FlyBaseID:FBgn0032666 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_006466.2 Gene:POSTN / 10631 HGNCID:16953 Length:836 Species:Homo sapiens


Alignment Length:480 Identity:92/480 - (19%)
Similarity:175/480 - (36%) Gaps:134/480 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VLELYGYKPLPDLPYTLIVPKIDVRSIEKPRLKEFMLEHVVPGKIFDSYNGNGNSKEEEESFGNG 155
            :||..|    .|..:||..|..:  :.||  |...:||.::                        
Human   259 ILEALG----RDGHFTLFAPTNE--AFEK--LPRGVLERIM------------------------ 291

  Fly   156 NGHKIVFRKLEKSHNNVWLLNGQQILHKLRINENLMAIAI----DG---YLGDRKSPYSKRNIQE 213
             |.|:....|.|.|          ||:.|:.:|::|..|:    :|   .:|......:...|:.
Human   292 -GDKVASEALMKYH----------ILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKM 345

  Fly   214 TNNRYNDPQPLEQPNITN---AHAKVEPVIKESKASPLMSFLANMKTGTKVFQHFLSKSNL-TRI 274
            .|         ::..:||   .|. ::.|:....|..::......:|   .|...:::..| :.:
Human   346 VN---------KKDIVTNNGVIHL-IDQVLIPDSAKQVIELAGKQQT---TFTDLVAQLGLASAL 397

  Fly   275 MDDNAYTVLIPSDNAF--------QRWHPIDWGFYPFSVPEFTESVLRNHFLPMQRPLRLADVRN 331
            ..|..||:|.|.:|||        ||               ..:.:|:||.|.::  :.|.::.|
Human   398 RPDGEYTLLAPVNNAFSDDTLSMDQR---------------LLKLILQNHILKVK--VGLNELYN 445

  Fly   332 MDEVVVTTMGGEDV-VFHGQPTPTVNNVSIMSDYNLSNGNQVFIISEVLFVTEAVVSKLHQMHKD 395
            ..  ::.|:||:.: ||..:....:.|..:...........:.|..|::...|   ..||:    
Human   446 GQ--ILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFREIIKPAE---KSLHE---- 501

  Fly   396 KETPPLLAFPWFGAQFLSHSFLALERDPRFTQITRYLNSAEIAPHIS-GANYTFFVPEDRAFEKQ 459
                                  .|::|.||:.....|.:|::...:: ..::|.|||.:.||  :
Human   502 ----------------------KLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAF--K 542

  Fly   460 GFDKLSDEVMASQRGV--KMLLNHFVKGRLYNRDLRD--NEVFETIGGGHIKITRNPGSNYTSVN 520
            |......|::...:..  .::|.|...|....:....  ..:.:|..|.  ||.....::...||
Human   543 GMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGS--KIFLKEVNDTLLVN 605

  Fly   521 NAQITESEVFVYNLGTMYYLDDILY 545
            ..:..||::...| |.::.:|.:||
Human   606 ELKSKESDIMTTN-GVIHVVDKLLY 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5758NP_001286028.1 FAS1 281..380 CDD:214719 22/107 (21%)
FAS1 447..545 CDD:214719 22/101 (22%)
POSTNNP_006466.2 Fasciclin 109..230 CDD:280607
Fasciclin 245..367 CDD:280607 31/160 (19%)
Fasciclin 382..494 CDD:280607 27/133 (20%)
Fasciclin 507..630 CDD:280607 28/128 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10900
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.