DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5758 and postn

DIOPT Version :9

Sequence 1:NP_001286028.1 Gene:CG5758 / 35083 FlyBaseID:FBgn0032666 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001106376.1 Gene:postn / 100127174 XenbaseID:XB-GENE-478502 Length:795 Species:Xenopus tropicalis


Alignment Length:303 Identity:64/303 - (21%)
Similarity:125/303 - (41%) Gaps:62/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 GTKVFQHFLSKSNLTRIMDD-NAYTVLIPSDNAFQRWHPIDWGFYPFSVPEFTESVLRN------ 315
            |....|.:..:|.|.:.::. .:||...||::|   |..:|        .:..:|:|.|      
 Frog   110 GATSTQDYSDRSELRKEIEGVGSYTFFAPSNDA---WQLLD--------SDVRDSLLSNVNIELL 163

  Fly   316 ---HFLPMQRPLRLADVRNMDEVVVTTM--GGEDVVFHGQPTPTVNNVSIMSDYNLSNGNQVFII 375
               |:..:.:.:...|::|  .:.||:|  ..|.|:.|     ..|.|..::...:.:|||: ..
 Frog   164 NALHYHMINKRMLTKDLKN--GLSVTSMFNNQELVINH-----YTNGVVTVNCARVIHGNQI-AT 220

  Fly   376 SEVLFVTEAVVSKLHQMHKDKETPPLLAFPWFGAQFLSHSFLALERDPRFTQITRYLNSAEIAPH 440
            :.|:.|.:.||:.:....:|                      .:|.:...|.......:||:...
 Frog   221 NGVVHVIDRVVTAVGNTIED----------------------FIESEDELTSFREAGVAAEVLAE 263

  Fly   441 I-SGANYTFFVPEDRAFEK--QGFDKLSDEVMASQRGVKMLLN-HFVKGRLYNRDLRDNEVFETI 501
            : ....||.|.|.:.||||  :|   :.:.:||.::.||.|:| |.:.....:..:....:.||:
 Frog   264 LGKKGQYTLFAPTNDAFEKLPRG---VLERIMADKQAVKALVNYHILNSVQCSEAIMGGSLLETL 325

  Fly   502 GGGHIKITRNPGSNYTSVNNAQITESEVFVYNLGTMYYLDDIL 544
            .|..::|..: |.:.|...|..:...::...| |.::.:|.:|
 Frog   326 EGSSLQIGCD-GDSLTVNGNKMVNRKDIVTTN-GVIHLIDQVL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5758NP_001286028.1 FAS1 281..380 CDD:214719 24/109 (22%)
FAS1 447..545 CDD:214719 26/101 (26%)
postnNP_001106376.1 Fasciclin 110..230 CDD:308211 30/138 (22%)
Fasciclin 246..368 CDD:308211 30/126 (24%)
Fasciclin 383..495 CDD:308211
Fasciclin 508..632 CDD:308211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10900
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.