DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15153 and CG13313

DIOPT Version :9

Sequence 1:NP_609863.1 Gene:CG15153 / 35080 FlyBaseID:FBgn0032663 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_648267.1 Gene:CG13313 / 39022 FlyBaseID:FBgn0035941 Length:415 Species:Drosophila melanogaster


Alignment Length:340 Identity:82/340 - (24%)
Similarity:115/340 - (33%) Gaps:112/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GTGGLAELDTCQYRVAPWSGQVCQVRVDFERLELPQPQLNANSGVLEC-VDFLQI-----QHFRL 101
            |.||     .|...|.|....:||:||||..|.|..|     ||...| .|.|.|     |...:
  Fly   150 GGGG-----RCSIVVTPPDSSICQLRVDFLSLSLAPP-----SGDGSCSTDALTITGGASQVPSI 204

  Fly   102 CGRNSGQHLYIPIRRGQELQLLFRLATSLGRQSTWQLTLTQLECPRDSARGVGTRQPEVQTPTVR 166
            ||.|:|||:|:.......:.:....:.|......||..:..|.|                     
  Fly   205 CGENAGQHVYVDFNGVSPITISVATSGSYTFNRNWQFQIRMLGC--------------------- 248

  Fly   167 PILPFLGNFLPRTIFGGQSGIGSGSGPAAQLIQTFTSPSSADLEMLAPLGCDQYYRTTTGGIVSF 231
                                               ||.:      |||.||.|||..::|.:.||
  Fly   249 -----------------------------------TSAT------LAPAGCLQYYMPSSGTLASF 272

  Fly   232 NF-------------AGGVYMPNMKYSICVKGAADN-EISYKITHFELSKANSEQPGPAYDTD-- 280
            |:             .|...:.|.||.||::.||.. .|:|       |:..|:........|  
  Fly   273 NYNSAAASALNSIGVQGTRQLANTKYGICIRKAAGMCSITY-------SQVGSDTYSFTLTNDVG 330

  Fly   281 -------CRSTVLTPLRVSDYVSIPDAYMVGRPELQATHYCGNGLAGQELVARPPFVLRFASDSQ 338
                   ..|:|.:....:||:.||.... |...:.:..:||.||......|: |||:...:|..
  Fly   331 AVDPTLLATSSVQSQECTTDYIIIPSPTQ-GGVAMPSDRFCGLGLVSTTTSAK-PFVVYTVTDGN 393

  Fly   339 SSG--SETGFQLTYT 351
            ...  |..||.|:|:
  Fly   394 EDMDISNRGFYLSYS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15153NP_609863.1 CUB 217..352 CDD:294042 42/160 (26%)
CG13313NP_648267.1 CUB 129..>214 CDD:294042 28/73 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.