DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and arr3b

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_957086.1 Gene:arr3b / 796867 ZFINID:ZDB-GENE-030616-74 Length:362 Species:Danio rerio


Alignment Length:363 Identity:136/363 - (37%)
Similarity:213/363 - (58%) Gaps:12/363 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEM 70
            ||:||.|.|..:.||:.||||||.|..|:.:||::.:|...: ..||::|||.|.|||||||.::
Zfish     3 KVYKKTSGNGSLCLYLGRRDFVDHVESVDSVDGVLKIDPSGL-NGRKVWVQLACAFRYGREDLDV 66

  Fly    71 IGLRFQKELTLVSQQVCPPQKQDIQLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASDE 135
            ||:.|:|::.:...|:.|.:......|.|||.||||.|...:||...:|...|.||.||....|.
Zfish    67 IGVSFRKDIWIKRIQMYPFEGTKPPNTPMQEALLKKAGDQGHPFTFDIPVHLPCSVSLQPAPEDA 131

  Fly   136 SQPCGVQYFVKIFTG---DSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELE 197
            .:||||.|.||.:..   |:..::..::.|..|.|||:||||.:....|...:.|.|:.:...:.
Zfish   132 GKPCGVDYEVKAYIANEEDNIDEKVEKKDTCRLIIRKIQYAPAELAAGPKADINKQFITADKPIH 196

  Fly   198 LEVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCP 262
            :||:::|:||:||:.|.:.:.|.|.::|||||||..:.|..|||::...::...:  :....|..
Zfish   197 MEVSMEKELYYHGDPIPIKVKVNNETSKVVKKIKINIFQITDVVIYAADKYHKCV--LNEEFGDQ 259

  Fly   263 LNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVK 327
            :|..|:.:|...:.|.||.|.::.|:|::|.:|.:||.|||:||:.....:...|::|||.:||.
Zfish   260 INANSTFEKEYSVTPLLVNNKEKRGLALDGRLKDEDTNLASSTLLIPDMDKQMQGVVVSYKIKVI 324

  Fly   328 LFLGA--LG----GELCAELPFILMHPKPSRKAQLEAE 359
            |.:|.  ||    .::.||||.:||.|||:..:.:..|
Zfish   325 LMMGGGLLGSLTSSDVTAELPLVLMSPKPAEISDINLE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 64/158 (41%)
Arrestin_C 192..350 CDD:214976 57/163 (35%)
arr3bNP_957086.1 Arrestin_N 16..172 CDD:278754 64/156 (41%)
Arrestin_C 192..353 CDD:214976 57/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.