DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and saga

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_956853.1 Gene:saga / 792319 ZFINID:ZDB-GENE-040426-1538 Length:392 Species:Danio rerio


Alignment Length:358 Identity:158/358 - (44%)
Similarity:229/358 - (63%) Gaps:8/358 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDD-EM 70
            ||||.|.:..:.:||.:|||||.|..|:|:||:|::|.|.:| .:|.:|.|.|.|||||:|| |:
Zfish     7 VFKKISKDKSVGVYMGKRDFVDRVDSVDPVDGVILIDPEQLR-GKKAYVTLSCVFRYGRDDDAEV 70

  Fly    71 IGLRFQKELTLVSQQVCP--PQKQDIQLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKAS 133
            :|:.|:||:.:.::||.|  ..|:...|||:||:||:|||.|||||..:.|.:.|.||.||....
Zfish    71 LGISFRKEIYISTRQVYPALQDKEQCILTKVQEKLLRKLGDNAYPFFFEFPDNLPCSVGLQPAPK 135

  Fly   134 DESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELEL 198
            |..:.|.|::.||.|..:|...:..:||::.|.||||||||.|.|..|.....:|||:|...|.|
Zfish   136 DVGKHCAVEFEVKAFCAESQDAKVRKRSSVGLMIRKVQYAPEKLGPAPSVETTRDFLMSDKPLHL 200

  Fly   199 EVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPL 263
            |.:|:||.|:|||.|:|.:.:.|.|||.|:.|...|:|..:|||:.|..:...:|..::  |..:
Zfish   201 EASLEKQTYYHGEPINVRVKINNQSNKNVRNIILSVEQNANVVLYCNDNYMKVVATEDS--GHSV 263

  Fly   264 NPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKL 328
            :.|:.|:||..|:|.|..|.:|.|||::|.:|.:||.|||:::|.....::..||:|||.|.|||
Zfish   264 DSGAKLEKVYTLLPLLANNRERRGIALDGKLKHEDTNLASSSIIKEGVQKEVLGIMVSYRVVVKL 328

  Fly   329 FLGALGG--ELCAELPFILMHPKPSRKAQLEAE 359
            .:|.:.|  |:..||||.||||||....:.|||
Zfish   329 IVGGMMGSSEVGVELPFQLMHPKPDAVKESEAE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 72/158 (46%)
Arrestin_C 192..350 CDD:214976 67/159 (42%)
sagaNP_956853.1 Arrestin_N 17..175 CDD:304627 72/158 (46%)
Arrestin_C 194..352 CDD:214976 67/159 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.