DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and SAG

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_000532.2 Gene:SAG / 6295 HGNCID:10521 Length:405 Species:Homo sapiens


Alignment Length:360 Identity:158/360 - (43%)
Similarity:225/360 - (62%) Gaps:11/360 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NFKVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDD 68
            |..:|||.|.:..:|:|:..||::|.|:||:|:||::::|.:.|: .:|::|.|.|.||||:||.
Human    13 NHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVK-GKKVYVTLTCAFRYGQEDI 76

  Fly    69 EMIGLRFQKELTLVSQQVCPPQKQDIQLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKAS 133
            ::|||.|:::|.....||.||.......||:||.||||||||.|||::..|...|.||:||....
Human    77 DVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQ 141

  Fly   134 DESQPCGVQYFVKIFTGDS---DCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGE 195
            |..:.|||.:.||.|..||   :.|:..::|::.|.|||||:||.:.|.||.......|.:|...
Human   142 DSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKP 206

  Fly   196 LELEVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEG 260
            |.|.|:|:|::|.|||.|.|.:.|.||:.|.||||||.|:|..:|||:.:..:...:|..|..|.
Human   207 LHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEK 271

  Fly   261 CPLNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVK 325
            .|  |.|:|.|.:.|:|.|..|.:|.|||::|.||.:||.|||:|:|.....|...||:|||.:|
Human   272 VP--PNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIK 334

  Fly   326 VKL----FLGAL-GGELCAELPFILMHPKPSRKAQ 355
            |||    |||.| ..|:..|:||.||||:|...|:
Human   335 VKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 70/158 (44%)
Arrestin_C 192..350 CDD:214976 75/162 (46%)
SAGNP_000532.2 Arrestin_N 26..184 CDD:278754 70/158 (44%)
Arrestin_C 203..364 CDD:214976 75/162 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.