DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and sagb

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001028921.1 Gene:sagb / 619268 ZFINID:ZDB-GENE-050913-98 Length:176 Species:Danio rerio


Alignment Length:153 Identity:63/153 - (41%)
Similarity:102/153 - (66%) Gaps:3/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEMI 71
            ::||.|.:..:.:||.:|||||....|:|:||::::|.|.|: ::|:||.|.|.|||||||.:::
Zfish     7 IYKKISRDKSVGVYMGKRDFVDHCDFVDPVDGVVLIDPEQVK-DKKVFVMLSCTFRYGREDMDVM 70

  Fly    72 GLRFQKELTLVSQQVCPP--QKQDIQLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASD 134
            |:.|::::.|..:||.||  .|:....||:||::|:|||.||:||..:.|.:.|.||.||...:|
Zfish    71 GMAFRRDIFLCMRQVYPPLQDKERSIHTKVQEKILRKLGGNAHPFFFEFPDNLPCSVTLQPAPND 135

  Fly   135 ESQPCGVQYFVKIFTGDSDCDRS 157
            ..:.|.|::.||.|..::..|.|
Zfish   136 VGKQCAVEFEVKAFCAENQDDNS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 60/143 (42%)
Arrestin_C 192..350 CDD:214976
sagbNP_001028921.1 Arrestin_N 17..150 CDD:304627 57/133 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.