DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and arrb1

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001153294.1 Gene:arrb1 / 553266 ZFINID:ZDB-GENE-060824-1 Length:418 Species:Danio rerio


Alignment Length:353 Identity:165/353 - (46%)
Similarity:238/353 - (67%) Gaps:11/353 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEM 70
            :||||.|||..:|:|:.:|||||.|..|||:||::::|.||::: ||:||.|.|.|||||||.::
Zfish     7 RVFKKASPNGKLTVYLGKRDFVDHVDLVEPVDGVVLIDPEYLKE-RKVFVTLTCAFRYGREDLDV 70

  Fly    71 IGLRFQKELTLVSQQVCPPQKQDIQ-LTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASD 134
            :||.|:|:|.:.:.|..||..::.: ||::||||:||||.:||||..::||:.|.||.||....|
Zfish    71 LGLTFRKDLFVANIQAFPPVPEEKKSLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPED 135

  Fly   135 ESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELE 199
            ..:.|||.:.||.|..::..::.|:|:::.|.||||||||.|.|.||.....:.||:|...|.||
Zfish   136 TGKACGVDFEVKAFCAENVEEKIHKRNSVRLVIRKVQYAPEKPGPQPMAETTRQFLMSDKPLHLE 200

  Fly   200 VTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPLN 264
            .:|||::|:|||.||||:.|.||:||.|||||..|:|..|:.||...|::..:|..|:.:  .:.
Zfish   201 ASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAIEESDD--IVA 263

  Fly   265 PGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKLF 329
            |.::..||..|.|.|..|.::.|:|::|.:|.:||.|||:||:.....::..||||||.|||||.
Zfish   264 PSATFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANKEILGIIVSYKVKVKLV 328

  Fly   330 L--GALGGELCA-----ELPFILMHPKP 350
            :  |.|.|:|.:     ||||.||||||
Zfish   329 VSRGGLLGDLASSDVAVELPFTLMHPKP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 73/156 (47%)
Arrestin_C 192..350 CDD:214976 74/164 (45%)
arrb1NP_001153294.1 Arrestin_N 18..174 CDD:278754 73/156 (47%)
Arrestin_C 193..356 CDD:214976 74/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.