DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and krz

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster


Alignment Length:350 Identity:177/350 - (50%)
Similarity:249/350 - (71%) Gaps:3/350 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEM 70
            :||||.|.|..||:|:.:|||||.||.|:||||::.:|.|||: :||:|.|::..|||||||.::
  Fly    48 RVFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVK-DRKVFGQVLAAFRYGREDLDV 111

  Fly    71 IGLRFQKELTLVSQQVCPPQKQDIQLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASDE 135
            :||.|:|:|.|..:|:.||.:.|..:|::||||:||||.||:||..::||..||||.||....|.
  Fly   112 LGLTFRKDLYLAHEQIYPPMQLDRPMTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDV 176

  Fly   136 SQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELEV 200
            .:.|||.|.:|.|.|::..|:.|:|:::.|.||||.|||:|.|.||...|.|:|::.|.::.||.
  Fly   177 GKSCGVDYELKAFVGENVEDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIHLEA 241

  Fly   201 TLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPLNP 265
            ||||:|||||||||||:.|.||||:.|||||..|:|..|:.||...|:::.:|.:|:.:||.:.|
  Fly   242 TLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQVAP 306

  Fly   266 GSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKLFL 330
            |.:|.||..|.|.|..|.|:.|:|::|.:|.:||.|||:|||.:...|::.||:|.|.|||||.:
  Fly   307 GFTLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVKLLI 371

  Fly   331 GA--LGGELCAELPFILMHPKPSRK 353
            .:  |.|:|.|||||.||||||..:
  Fly   372 SSPLLNGDLVAELPFTLMHPKPEEE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 77/155 (50%)
Arrestin_C 192..350 CDD:214976 82/159 (52%)
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 77/155 (50%)
Arrestin_C 233..393 CDD:214976 82/159 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470071
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.802101 Normalized mean entropy S2648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.