DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and CG32683

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster


Alignment Length:533 Identity:127/533 - (23%)
Similarity:197/533 - (36%) Gaps:196/533 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEM 70
            :|:||.|||.::|||:..|:...:......:.||:.:|.:.: |..:::.||...|||||||:|:
  Fly   103 RVYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAI-QGYRVYAQLTLTFRYGREDEEV 166

  Fly    71 IGLRFQKELTLVSQQVCPPQKQDI--QLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKAS 133
            :||||..|..:...|:.|..::..  .|:.:||.|:|:||..|:||.:.:...:|.||.|.....
  Fly   167 MGLRFCNEAIMSLHQIWPRLEEPTPESLSPLQEALMKRLGDGAHPFTLSLSSYAPPSVQLVPAKR 231

  Fly   134 DESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKV-------------QYAP----------- 174
            ....|.|..|.|:.|..|...::.|||:::.:|:|.:             |||.           
  Fly   232 YYGAPIGTSYDVRCFIADKTDEKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAGRQNIAQSP 296

  Fly   175 --------------------------------------------------------------TKQ 177
                                                                          :|.
  Fly   297 PASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFSGRFGRSKS 361

  Fly   178 GIQPCT--------------------------------------------VVRKDFLLSPGELEL 198
            .|:.|.                                            .|.|.|||..|.:.|
  Fly   362 EIEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVDKPFLLHDGRVGL 426

  Fly   199 EVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCP- 262
            ..:|||..|.|||.:.|.:.:||:|.|.|:|::....|.|||.:|.||:|:|.:|  ::....| 
  Fly   427 RASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVA--DSDNVTPP 489

  Fly   263 ----LNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIAS-------------- 309
                :..|:||...:.|.|.  ....:..||:|..::|.......|..||:              
  Fly   490 VDRTVAAGASLNTTVTLRPQ--RGPTKNWIALEDTLQRSTEPEEITGAIAASAIRSPHFVMQNAQ 552

  Fly   310 ----------------------------------------QDARDAFGIIVSYAVKVKLFLGALG 334
                                                    .:.|:.|.|.|||.|||||.|..:|
  Fly   553 LLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKVKLTLSGMG 617

  Fly   335 GELCAELPFILMH 347
            |||..:|||:|:|
  Fly   618 GELSLKLPFVLVH 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 51/170 (30%)
Arrestin_C 192..350 CDD:214976 60/215 (28%)
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 46/133 (35%)
Arrestin_C 421..632 CDD:214976 60/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.802101 Normalized mean entropy S2648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34511at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.