DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and arr-1

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_508183.1 Gene:arr-1 / 180446 WormBaseID:WBGene00000195 Length:435 Species:Caenorhabditis elegans


Alignment Length:369 Identity:163/369 - (44%)
Similarity:239/369 - (64%) Gaps:10/369 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEM 70
            :||||.|||..||.|:.:|||:|....|:.|||::::|:||::.|||:...|:..|||||||.::
 Worm    11 RVFKKTSPNGKITTYLGKRDFIDRGDYVDLIDGMVLIDEEYIKDNRKVTAHLLAAFRYGREDLDV 75

  Fly    71 IGLRFQKELTLVSQQVCPPQKQDIQ--LTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKAS 133
            :||.|:|:|...:.||.|...:.|.  |:::||||.:|||:||:||..::.|.|.:||.||....
 Worm    76 LGLTFRKDLISETFQVYPQTDKSISRPLSRLQERLKRKLGANAFPFWFEVAPKSASSVTLQPAPG 140

  Fly   134 DESQPCGVQYFVKIFTGDSDCD------RSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLS 192
            |..:||||.|.:|.|...:|..      :|...:|:.|.|||:.|||.:...||...|.|.|::|
 Worm   141 DTGKPCGVDYELKTFVAVTDGSSGEKPKKSALSNTVRLAIRKLTYAPFESRPQPMVDVSKYFMMS 205

  Fly   193 PGELELEVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMET 257
            .|.|.:||:|||::|:|||.||||:.::|||||.|||:|..:.|..|:.||....:...:|.:|:
 Worm   206 SGLLHMEVSLDKEMYYHGESISVNVHIQNNSNKTVKKLKIYIIQVADICLFTTASYSCEVARIES 270

  Fly   258 SEGCPLNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSY 322
            :||.|:.||.:|.||..:.|.|..|.|:.|:|::|.:|.:||.|||:|::.|:.::::.||:|.|
 Worm   271 NEGFPVGPGGTLSKVFAVCPLLSNNKDKRGLALDGQLKHEDTNLASSTILDSKTSKESLGIVVQY 335

  Fly   323 AVKVKLFLGALGGELCAELPFILMHPKPSRKAQLEAEG--SIEA 364
            .|||:..||.|.|||.|||||.|.|.||....:....|  ||||
 Worm   336 RVKVRAVLGPLNGELFAELPFTLTHSKPPESPERTDRGLPSIEA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 67/163 (41%)
Arrestin_C 192..350 CDD:214976 74/157 (47%)
arr-1NP_508183.1 Arrestin_N 22..186 CDD:278754 67/163 (41%)
Arrestin_C 205..363 CDD:214976 74/157 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.802101 Normalized mean entropy S2648
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.