DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and Arr3

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001177922.1 Gene:Arr3 / 171107 RGDID:621385 Length:381 Species:Rattus norvegicus


Alignment Length:364 Identity:151/364 - (41%)
Similarity:227/364 - (62%) Gaps:12/364 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEMI 71
            ||||.|.|...::|:.:|||||.|..||||||:|::|.||:: .||:||:|.|.|||||:|.::|
  Rat     4 VFKKTSSNGKFSIYLGKRDFVDDVDTVEPIDGVILVDPEYLK-GRKMFVRLTCAFRYGRDDLDVI 67

  Fly    72 GLRFQKELTLVSQQVCPPQKQDIQ--LTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASD 134
            ||.|:|:|.:.::||.|.:...||  ||.:|||||.|||.|||||.:||..:.|.||.||....|
  Rat    68 GLTFRKDLYVQTKQVAPAEPTSIQGPLTALQERLLHKLGVNAYPFTLQMVANLPCSVTLQPGPED 132

  Fly   135 ESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELE 199
            ..:||||.:.||.|..::..::..:..::.|.:||||::..:.|..|.....:.|.||...|:|:
  Rat   133 SGKPCGVDFEVKSFCAENLEEKISKSDSVQLVVRKVQFSALEPGPGPWAQTIRSFFLSSQPLQLQ 197

  Fly   200 VTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPLN 264
            ..:|:::::|||.|||::.:.|.:|||:::||..|.|..||||:...::..|:...|.:|....|
  Rat   198 AWMDREVHYHGEAISVHVSINNYTNKVIRRIKIAVIQITDVVLYSLDKYTKTVFIREFTETVAAN 262

  Fly   265 PGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKLF 329
              ||..:...:.|.|.||..:.|:|::|.:|.:||.|||:|::.....::..||:|||.|||.|.
  Rat   263 --SSFSQTFAVTPLLAANRQKQGLALDGKLKHEDTNLASSTILRPGMNKELLGILVSYKVKVNLM 325

  Fly   330 L---GALGG----ELCAELPFILMHPKPSRKAQLEAEGS 361
            :   |.|||    ::..|||.||:||||....:..|..|
  Rat   326 VSYGGILGGLPASDVGVELPLILIHPKPPHGERAVATSS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 75/157 (48%)
Arrestin_C 192..350 CDD:214976 62/164 (38%)
Arr3NP_001177922.1 Arrestin_N 14..171 CDD:278754 75/157 (48%)
Arrestin_C 190..353 CDD:214976 62/164 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.