DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr1 and arrb1

DIOPT Version :9

Sequence 1:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_004912283.1 Gene:arrb1 / 100486349 XenbaseID:XB-GENE-481578 Length:461 Species:Xenopus tropicalis


Alignment Length:357 Identity:164/357 - (45%)
Similarity:241/357 - (67%) Gaps:10/357 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FKVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDE 69
            |.||||.|||..:|:|:.:|||||.:..|:|:||::::|.||::: ||:||.|.|.|||||||.:
 Frog    48 FLVFKKASPNGKLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKE-RKVFVTLTCAFRYGREDLD 111

  Fly    70 MIGLRFQKELTLVSQQVCPPQKQDIQ-LTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKAS 133
            ::||.|:|:|.:.:.|..||..::.: ||::||||:||||.:||||..::||:.|.||.||....
 Frog   112 VLGLTFRKDLFVANIQAFPPVPEEKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPE 176

  Fly   134 DESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELEL 198
            |..:.|||.|.||.|..::..::.|:|:::.|.||||||||.:.|.||.....:.||:|...|.|
 Frog   177 DTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHL 241

  Fly   199 EVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPL 263
            |.:|||::|:|||.|:||:.|.||:||.|||||..|:|..|:.||...|::..:| :|.::...:
 Frog   242 EASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVA-VEEADNDVV 305

  Fly   264 NPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKL 328
            .|.|:..||..|.|.|..|.::.|:|::|.:|.:||.|||:||:.....::..||||||.|||||
 Frog   306 APSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKL 370

  Fly   329 FL--GALGGELCA-----ELPFILMHPKPSRK 353
            .:  |.|.|:|.:     ||||.||||||:.:
 Frog   371 VVSRGGLLGDLASSDVAVELPFTLMHPKPTEE 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 72/156 (46%)
Arrestin_C 192..350 CDD:214976 74/164 (45%)
arrb1XP_004912283.1 Arrestin_N 60..216 CDD:278754 72/156 (46%)
Arrestin_C 235..399 CDD:214976 74/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.