DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and LRX2

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_176434.2 Gene:LRX2 / 842542 AraportID:AT1G62440 Length:786 Species:Arabidopsis thaliana


Alignment Length:534 Identity:111/534 - (20%)
Similarity:187/534 - (35%) Gaps:167/534 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 RDVKRLTKVL---LDGNQLSVVVDQLFRMQKSLNHLDLSYNR-LAKVPNDSFLQLTNLTFLDLSY 307
            |::..||.:.   |:.|:....|...|:..|.|..||||.|| :.|.|| ..|.|.:|.||||.|
plant   119 RELGLLTDLALFHLNSNRFCGEVPLTFKHMKLLFELDLSNNRFVGKFPN-VVLSLPSLKFLDLRY 182

  Fly   308 NKLVRLEPQSIRSLSNLLTLNISGNVLMDLREMRETFEPLIYYFFLTCSKLFFQLIPQ------L 366
            |:.....|..:                         |:..:...||..::..|. ||:      :
plant   183 NEFEGSIPSKL-------------------------FDKELDAIFLNHNRFMFG-IPENMGNSPV 221

  Fly   367 THLAIADM---GTMP--VGLLHPFKQLRYLNISGNSLNNTALEVIDPCRELEFLDLSRNQLHGIS 426
            :.|.:||.   |.:|  :||:.  |.|..:.:|.::|.......|...:.:...|:|.|:|.|..
plant   222 SALVLADNDLGGCIPGSIGLMG--KTLNEIILSNDNLTGCLPPQIGNLKNVTVFDISFNRLSGPL 284

  Fly   427 EDTVLRIQGIRNVRLDNNPLICDECHMGKLINVVRQLQWKWDTYPICFLPKSLRGAEINNLDING 491
            ..::..::.:..:.:.||          :...|:               |.|:  .:::||: |.
plant   285 PSSIGNMKSLEQLNVANN----------RFTGVI---------------PSSI--CQLSNLE-NF 321

  Fly   492 LHTCLTFITDEEQNAASTSYNFLEHGGLNTLAILGGIIFVLIAVIILSLVACFSKNRARYYTRED 556
            .::...|..|..:..|....|.:.:|.:|                      |..       .:||
plant   322 TYSSNFFTGDAPRCVALLGDNVVVNGSMN----------------------CID-------GKED 357

  Fly   557 HLNGSESKCLEKNLEATTITTLG--NGSSP------TTTTTLTLATSP----------AAPNGPK 603
            ..:..|  |......:...:..|  |..||      .:.|...|...|          |.|..|.
plant   358 QRSSKE--CSSPASRSVDCSKFGCNNFFSPPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPS 420

  Fly   604 TNGQGLSLSPANGSTPVHGISDDKGKEINFTF-----PVDDRVCTIDELMPSPPPPPQQHPHPNM 663
            :     .:||:..:||     .....:::.:|     |...::....:..|.|||||:..|.|  
plant   421 S-----KMSPSFRATP-----PPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSP-- 473

  Fly   664 GSLMYSVSHSPNSATTLAAVAAAATVIPPGAPS---------HSSMPTPTPTPAEAVVVVLPPP- 718
                      |..::.::....|....||.:|.         :||.|.|:|:|....:...||| 
plant   474 ----------PPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPV 528

  Fly   719 ---------PLPPQ 723
                     |.||:
plant   529 VNCPPTTQSPPPPK 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
LRR_8 131..190 CDD:290566
leucine-rich repeat 132..155 CDD:275380
LRR_RI 151..422 CDD:238064 49/189 (26%)
leucine-rich repeat 156..179 CDD:275380
LRR_8 178..262 CDD:290566 5/17 (29%)
leucine-rich repeat 180..203 CDD:275380
leucine-rich repeat 204..251 CDD:275380 1/3 (33%)
leucine-rich repeat 252..275 CDD:275380 6/25 (24%)
LRR_8 274..334 CDD:290566 21/60 (35%)
leucine-rich repeat 276..299 CDD:275380 12/23 (52%)
LRR_4 298..342 CDD:289563 8/43 (19%)
leucine-rich repeat 300..323 CDD:275380 8/22 (36%)
leucine-rich repeat 388..411 CDD:275380 4/22 (18%)
LRX2NP_176434.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I2198
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.