Sequence 1: | NP_001286024.1 | Gene: | rdo / 35077 | FlyBaseID: | FBgn0243486 | Length: | 757 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_197937.1 | Gene: | AT5G25550 / 832630 | AraportID: | AT5G25550 | Length: | 433 | Species: | Arabidopsis thaliana |
Alignment Length: | 287 | Identity: | 76/287 - (26%) |
---|---|---|---|
Similarity: | 120/287 - (41%) | Gaps: | 59/287 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 NITENNFRGQ--------------DNLLE----LDLSKNKVLRMASSTFRHLTDLRRLNLADNSI 166
Fly 167 VELVQRNFFMLSRLKYLDLSGNPLQDLQPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSEL 231
Fly 232 DLGRNEFKFLDKDEFRDV-------KRLTKVLLDGNQLSVVVDQLF-RMQKSLNHLDLSYNRLAK 288
Fly 289 -VPNDSFLQLTNLTFLDLSYNKLVRLEPQSIRSLSNLLTLNISGNV--------LMDLREMRE-- 342
Fly 343 ------TFEPLI------YYFFLTCSK 357 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rdo | NP_001286024.1 | leucine-rich repeat | 84..107 | CDD:275380 | |
leucine-rich repeat | 108..131 | CDD:275380 | 4/24 (17%) | ||
LRR_8 | 131..190 | CDD:290566 | 16/62 (26%) | ||
leucine-rich repeat | 132..155 | CDD:275380 | 4/26 (15%) | ||
LRR_RI | 151..422 | CDD:238064 | 68/238 (29%) | ||
leucine-rich repeat | 156..179 | CDD:275380 | 3/22 (14%) | ||
LRR_8 | 178..262 | CDD:290566 | 24/90 (27%) | ||
leucine-rich repeat | 180..203 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 204..251 | CDD:275380 | 12/53 (23%) | ||
leucine-rich repeat | 252..275 | CDD:275380 | 4/23 (17%) | ||
LRR_8 | 274..334 | CDD:290566 | 27/68 (40%) | ||
leucine-rich repeat | 276..299 | CDD:275380 | 10/23 (43%) | ||
LRR_4 | 298..342 | CDD:289563 | 18/51 (35%) | ||
leucine-rich repeat | 300..323 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 388..411 | CDD:275380 | |||
AT5G25550 | NP_197937.1 | leucine-rich repeat | 149..172 | CDD:275380 | 8/22 (36%) |
LRR_8 | 151..206 | CDD:290566 | 18/63 (29%) | ||
leucine-rich repeat | 173..195 | CDD:275380 | 6/27 (22%) | ||
leucine-rich repeat | 196..220 | CDD:275380 | 5/26 (19%) | ||
leucine-rich repeat | 221..242 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 10/23 (43%) | ||
leucine-rich repeat | 268..291 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 292..315 | CDD:275380 | 6/22 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 98 | 1.000 | Inparanoid score | I2198 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |