DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and CG5810

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:382 Identity:89/382 - (23%)
Similarity:177/382 - (46%) Gaps:59/382 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KLEILRI--------TDSNL--PAIGAESFWG---LKYLR---ILDLSKNNITNITENNFRGQDN 131
            |||.:.|        |.:||  |:..|.:::.   .|:||   .|.|..:::.|:....|.....
  Fly    24 KLEEIAIDSLDCRENTCTNLKYPSASAVAYFSENVTKHLRKYETLVLHSSDLANLPRKIFLNLPQ 88

  Fly   132 LLELDLSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRLKYLDLSGNPLQDLQPD 196
            |:|..:.:.::.::.|..|....:|:|||...|::..|....|.:.::|:.|:||.|.|:||...
  Fly    89 LVEFHVLECELQQIESVCFDGAKNLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTT 153

  Fly   197 VFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNEFKFLDKDEFRDV-KRLTKVLLDGN 260
            :||.:..|:.:...|.:|..::..:::.|..|..:::..|:...|..:.|||. |.|::.....|
  Fly   154 IFRPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINVDSNQLVELPGELFRDQRKHLSEFSAQSN 218

  Fly   261 QLSVVVDQLFRMQKSLNHLDLSYN----RL---AKVPNDSFLQLTNLTFLDLSYNKLVRLEPQSI 318
            ||..:...:||   .::||.||:|    ||   ||: |:  |:.||   .||          :|:
  Fly   219 QLVRIPFNIFR---EIDHLSLSFNPQLRRLHLSAKI-NE--LEATN---CDL----------ESV 264

  Fly   319 RSLSNLLTLNISGNVLMDLREMRETFEPLIYYFFLTCSKL----FFQLIPQLTHLAIAD---MGT 376
            .....::.:.:..|  ..|.|::.:....:.:.:|..:.|    |.....:|..|.:.|   :..
  Fly   265 ELDGRVIGVQLEAN--PKLHELKISQPQDLEHLYLANTNLYRLDFLSKASKLVDLDVTDIVNLAD 327

  Fly   377 MPVGLLHPFKQLRYLNISGNSLNNTALEVIDPCRELEFLDLSRNQ-----LHGISED 428
            :|  .:...|.|..|:.:.::|.:..::::...::|.:|::|..:     :..:.||
  Fly   328 LP--KITSAKGLERLSFTYDNLTSNHMDMLPHLKDLNYLEISHEKGKEIFIKDLDED 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 8/35 (23%)
leucine-rich repeat 108..131 CDD:275380 6/25 (24%)
LRR_8 131..190 CDD:290566 16/58 (28%)
leucine-rich repeat 132..155 CDD:275380 4/22 (18%)
LRR_RI 151..422 CDD:238064 67/290 (23%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
LRR_8 178..262 CDD:290566 23/84 (27%)
leucine-rich repeat 180..203 CDD:275380 10/22 (45%)
leucine-rich repeat 204..251 CDD:275380 10/47 (21%)
leucine-rich repeat 252..275 CDD:275380 6/22 (27%)
LRR_8 274..334 CDD:290566 17/66 (26%)
leucine-rich repeat 276..299 CDD:275380 11/29 (38%)
LRR_4 298..342 CDD:289563 8/43 (19%)
leucine-rich repeat 300..323 CDD:275380 3/22 (14%)
leucine-rich repeat 388..411 CDD:275380 3/22 (14%)
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 4/22 (18%)
LRR_8 87..147 CDD:290566 16/59 (27%)
leucine-rich repeat 89..112 CDD:275380 4/22 (18%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..195 CDD:290566 16/59 (27%)
LRR_4 135..175 CDD:289563 13/39 (33%)
leucine-rich repeat 137..160 CDD:275380 10/22 (45%)
leucine-rich repeat 161..184 CDD:275380 4/22 (18%)
leucine-rich repeat 185..209 CDD:275380 6/23 (26%)
leucine-rich repeat 210..231 CDD:275380 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.