DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and cDIP

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:382 Identity:94/382 - (24%)
Similarity:172/382 - (45%) Gaps:67/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LRQFMKLEILRITDSNLPAIGAE-SFW-----GLKYLRILDLSKNNITNITENNFRGQDNLLELD 136
            ||.|..||   :::.::...|.. .:|     |...|.||.||.|:|..:....|||..||..:.
  Fly   110 LRLFYTLE---VSELDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEVLPTKTFRGAGNLEFIF 171

  Fly   137 LSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRLKYLDLSGNPLQDLQPDVFRDV 201
            |::||:.::.:..|.:|..|:.|:|.:|.:..|....|..|..|:::.|:||.|..::.|:|...
  Fly   172 LNRNKLGKLQAGAFDNLLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQLTTIESDLFAHN 236

  Fly   202 PELKVLKCRNCQLKKINPQMYNLLPLLSELDLGR-NEFKFLDKDEFRDVKRLTKVLLDGNQLSVV 265
            |:|..:..:|.:|:::....:.        ..|| ::.:::|   ..:...|..:||:.|..::.
  Fly   237 PDLLSVAMQNNRLREVGEYAFR--------SRGRHHQMQYVD---LSNNPELVVLLLNINATNLT 290

  Fly   266 -----VDQLFRMQKSLNHLDLSYNRLAKVPNDSFLQLTNLTFLDLSYNKLVRLEPQSIRSLSNLL 325
                 :|:: .:..|:.::|||.||:.::   .|.....|..|.|..|.||:|  .|:..:..|.
  Fly   291 ARNCSLDRV-NLYGSVTNVDLSDNRVREL---YFPASEALEHLVLRNNSLVQL--ASLSRVPRLR 349

  Fly   326 TLNISGNVLMDLREMRETFEPLIYYFFLTCSKLFFQLIPQLTHLAIADMGTM--PVGLLHPFKQL 388
            .|:::.|  .:|.::.:.:.                 .|.|..|.:.:.|.|  |:..|...:.|
  Fly   350 HLDVADN--PNLGQLPDGWR-----------------TPHLEMLVLRNTGQMELPLEALQGMQNL 395

  Fly   389 RYLNISGNSLNNTALEVIDPCRELEFLDLSRNQLHGIS---------EDTVLRIQGI 436
            :.|:||||:|..     |||........|:...:||.:         .|.::|..||
  Fly   396 QKLDISGNNLTE-----IDPSAFPTLTQLTHFYIHGNNWNCFSLRNIMDVLIRANGI 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 5/28 (18%)
leucine-rich repeat 108..131 CDD:275380 10/22 (45%)
LRR_8 131..190 CDD:290566 18/58 (31%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
LRR_RI 151..422 CDD:238064 64/278 (23%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
LRR_8 178..262 CDD:290566 18/84 (21%)
leucine-rich repeat 180..203 CDD:275380 7/22 (32%)
leucine-rich repeat 204..251 CDD:275380 6/47 (13%)
leucine-rich repeat 252..275 CDD:275380 5/27 (19%)
LRR_8 274..334 CDD:290566 18/59 (31%)
leucine-rich repeat 276..299 CDD:275380 6/22 (27%)
LRR_4 298..342 CDD:289563 12/43 (28%)
leucine-rich repeat 300..323 CDD:275380 8/22 (36%)
leucine-rich repeat 388..411 CDD:275380 10/22 (45%)
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 3/23 (13%)
LRR_RI 143..407 CDD:238064 76/299 (25%)
leucine-rich repeat 143..166 CDD:275380 10/22 (45%)
LRR_8 166..225 CDD:290566 18/58 (31%)
leucine-rich repeat 167..190 CDD:275380 6/22 (27%)
leucine-rich repeat 191..214 CDD:275380 7/22 (32%)
leucine-rich repeat 215..238 CDD:275380 7/22 (32%)
leucine-rich repeat 239..265 CDD:275380 5/33 (15%)
leucine-rich repeat 266..325 CDD:275380 13/65 (20%)
LRR_8 304..357 CDD:290566 18/59 (31%)
leucine-rich repeat 326..347 CDD:275380 8/22 (36%)
leucine-rich repeat 348..394 CDD:275380 11/64 (17%)
LRR_8 369..428 CDD:290566 20/63 (32%)
LRR_4 393..433 CDD:289563 13/44 (30%)
leucine-rich repeat 395..418 CDD:275380 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453827
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.