DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and CG7800

DIOPT Version :10

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster


Alignment Length:463 Identity:108/463 - (23%)
Similarity:180/463 - (38%) Gaps:104/463 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LRQFMKLEILRITDSNLPAIGAESFWGLKYLRILDLSKNNITNITENNFRGQDNLLELDLSKNKV 142
            |.|...|..|::...||..:..|.|.....::||.|..||||.::...|:|...|..|.|..|.:
  Fly    83 LNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGI 147

  Fly   143 LRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRLKYLDLSGNPLQDLQPDVFRDVPELKVL 207
            ..:....|::|.:|..|:|:.|.|..|.:..|..:.:|:.|.|:||||..:.|...:.:..|::|
  Fly   148 QGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLL 212

  Fly   208 KCRNCQ--------------LKKINPQMYNLLPLLSELDLGRN---EFKFLDKDEFRDVKRLTKV 255
            ...||.              |.....|..::|..:.:|...:|   |.|..||....::. |...
  Fly   213 DMSNCGPLPDLSLPGAHTLILDNSGVQRLDILGSVHKLQARKNHITEIKLPDKSSVIELD-LHSN 276

  Fly   256 LLDGNQLSVVVDQLFRMQK--------------------------SLNHLDLSYNRLAKVPNDSF 294
            ||....:..::..::|:|:                          :|.:::||.|||.::..||.
  Fly   277 LLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSP 341

  Fly   295 LQLTNLTFLDLSYNKLVRLEPQSIRSLSNLLTLNISGNVLMDLREMRETFEPLIYYFFLTCSKLF 359
            :....||.||.|||::.......|....||.:|::.||.:.:              |.||..|..
  Fly   342 IPWERLTHLDASYNRIYAPAKVGIDEAFNLQSLHLEGNYINN--------------FELTPWKPH 392

  Fly   360 FQLIPQLTHLAIADMGTMPVGLLHPFKQL-RYLNISG--------NSLNNTALEVIDPCRELEFL 415
                |.|..:|:.|....|.|    :|.: ::.|..|        .|.:|.......||     :
  Fly   393 ----PSLKEVALYDNKFQPKG----YKNITKFFNEIGVNVLEKTQYSQSNNTTPTCKPC-----I 444

  Fly   416 DLSRNQLHGISEDTVLRIQGIRNVRLDN--NPLICDECHMGKLINVVRQLQWKWDTYPICFLPKS 478
            ..:|:....||.||        |..:|.  |||..|              .::|:.:.:..|...
  Fly   445 PDARDFPTSISADT--------NQTIDTKVNPLSND--------------TYQWNVWNVLMLVSL 487

  Fly   479 LRGAEINN 486
            :....:|:
  Fly   488 IVSLFVNS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 LRR 69..>446 CDD:443914 102/421 (24%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..203 CDD:275380 8/22 (36%)
leucine-rich repeat 204..251 CDD:275380 13/63 (21%)
leucine-rich repeat 252..275 CDD:275380 5/48 (10%)
leucine-rich repeat 276..299 CDD:275380 8/22 (36%)
leucine-rich repeat 300..323 CDD:275380 8/22 (36%)
leucine-rich repeat 388..411 CDD:275380 6/31 (19%)
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380
leucine-rich repeat 65..85 CDD:275380 1/1 (100%)
LRR 68..482 CDD:443914 106/448 (24%)
leucine-rich repeat 89..112 CDD:275380 6/22 (27%)
leucine-rich repeat 113..136 CDD:275380 9/22 (41%)
leucine-rich repeat 137..160 CDD:275380 6/22 (27%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..246 CDD:275380 7/36 (19%)
leucine-rich repeat 247..267 CDD:275380 6/19 (32%)
leucine-rich repeat 268..292 CDD:275380 3/24 (13%)
leucine-rich repeat 293..322 CDD:275380 1/28 (4%)
leucine-rich repeat 395..406 CDD:275378 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.