DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and CG42709

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:524 Identity:105/524 - (20%)
Similarity:183/524 - (34%) Gaps:163/524 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LKYLRILDLSKNNI-------TNITENNFRGQDNLLEL-------DLSKNKVLRMASS-----TF 150
            |.:|..:.:|..|.       .|..|:...|.|:..|.       :.::|:::..:||     ||
  Fly    11 LIFLLSVSISHTNAAPAGSEEANPLEDFNYGDDDYSETATGEESPETAENRLMPQSSSTSTTTTF 75

  Fly   151 RHLTDLRRLNLADNSIVE-LVQRNFFMLSRLKY---------------------LDLSGNPLQDL 193
            |.:.::.|   ..|.::| ...||...|...|:                     :|||.|.:.:|
  Fly    76 RPIFNIPR---RSNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAEL 137

  Fly   194 QPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNEFKFLDKDEFRDVKRLTKVLLD 258
            :|:.|.:                        |....|::|..|....:|||.|:..:||.::.|.
  Fly   138 RPEDFAN------------------------LSRAVEINLNHNLISSIDKDVFQGSERLKRLRLA 178

  Fly   259 GNQLSVVVDQLFRMQKSLNHLDLSYNRLAKVPNDSFLQLTNLTFLDLSYNKLVRLEPQSIRSLSN 323
            .|:|:.:....|...|.|..||||.|.:.:..:.|||...:|............|..|:.:::|.
  Fly   179 NNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPDLVEFSCVNCSWTELPEQTFQNMSG 243

  Fly   324 LLTLNISGNVLMDLREMRET--FEPLIYYFFLTCSKLFFQLIPQLTHLAIADMGTMPVGLLHPFK 386
            |..|.::.|   |.::...|  |.||        :|:....:|:|....|.::    ..||....
  Fly   244 LEVLRLNKN---DFKQQINTKAFSPL--------TKIIKLKLPELEQQNIEEL----CSLLTSID 293

  Fly   387 QLRYLN--------ISGNSLNNTALEVIDPCRELEFLDLSRNQLHGISEDTVLRIQGIRNVRLDN 443
            .:.:||        :.|...|.:.:...:|            .|.||:                |
  Fly   294 TISFLNYDISCYEFVLGTPFNGSLIYPTEP------------PLKGIT----------------N 330

  Fly   444 NPLICDECHMGKLINVVRQLQWKWDTYPICFLPKSLRGA-----------EINNLDINGLHTCLT 497
            .|::.......|               |:...|...|.|           |:....|....|..:
  Fly   331 PPIVASITSTAK---------------PVTATPAPPRSANRNRGKMDNSTELVKAGILSSETSTS 380

  Fly   498 FITDEEQNAASTSYNFLEHGGLNTLAILGGIIFVLIAV-IILSLVACFSKNRARYYTREDHLNGS 561
            .::.|....:.|:...:....:|||.|   .|.||..: |::.|:.           |:| :.|.
  Fly   381 GVSVEPPAESQTNQVQISQEAINTLLI---CIMVLAVIGIVIGLIC-----------RQD-IGGI 430

  Fly   562 ESKC 565
            ::||
  Fly   431 KTKC 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 1/1 (100%)
leucine-rich repeat 108..131 CDD:275380 6/29 (21%)
LRR_8 131..190 CDD:290566 18/92 (20%)
leucine-rich repeat 132..155 CDD:275380 7/34 (21%)
LRR_RI 151..422 CDD:238064 62/302 (21%)
leucine-rich repeat 156..179 CDD:275380 6/23 (26%)
LRR_8 178..262 CDD:290566 20/104 (19%)
leucine-rich repeat 180..203 CDD:275380 8/43 (19%)
leucine-rich repeat 204..251 CDD:275380 8/46 (17%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
LRR_8 274..334 CDD:290566 17/59 (29%)
leucine-rich repeat 276..299 CDD:275380 9/22 (41%)
LRR_4 298..342 CDD:289563 8/43 (19%)
leucine-rich repeat 300..323 CDD:275380 3/22 (14%)
leucine-rich repeat 388..411 CDD:275380 5/30 (17%)
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 19/79 (24%)
leucine-rich repeat 128..147 CDD:275380 8/42 (19%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR_RI <150..225 CDD:238064 24/74 (32%)
LRR_8 171..254 CDD:290566 23/85 (27%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 3/22 (14%)
leucine-rich repeat 244..268 CDD:275380 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453756
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.