DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and CG6749

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:498 Identity:127/498 - (25%)
Similarity:195/498 - (39%) Gaps:109/498 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LFKWLL---------FSLCIMPAMFSNTKRKCPTECQC----SMDDL-----DRYQAICTK---- 44
            |..|||         ..|| .|..:.|        .||    |:.||     :.:..:..:    
  Fly    11 LLLWLLCMGFPILHGADLC-QPIGWRN--------FQCSEVASLQDLVDLGAENWHTLAIRNVQT 66

  Fly    45 -----GGLNSLLSPNELDVDVK-VIIIRGPRNSITIGPALRQFMKLEILRITDSNLPAIGAESFW 103
                 .|.|:....|.||:|:. ...|....|..:|.|.|||      |.::...|..|....|.
  Fly    67 ELEVGSGENADHLANLLDLDLTGAAPINVHTNGFSILPNLRQ------LNLSGCGLVDIRGNHFA 125

  Fly   104 GLKYLRILDLSKN-----------NITNITENNFRGQDNLLELDLSKNKVL--------RMASST 149
            ....|:.:|.|.|           |:..:...|| ..:.|.:.||....:|        |:.::|
  Fly   126 PESALQRIDFSHNQMELLDRDFFGNLRKLIYANF-SHNALKQCDLPHMPLLNRLELGHNRLVNAT 189

  Fly   150 FRHLTDLRRLNLADNSIVELVQRNFFMLSRLKYLDLSGNPLQDLQPDVFRDVPELKVLKCRNCQL 214
            |.....|:.|.|.||.:::|....|..|..|..|.||||.|..:..:.|:.:.:|:.|......|
  Fly   190 FGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNAL 254

  Fly   215 KKINPQMY----NLLPLLSELDLGRNEFKFLDKDEFRDVKRLTKVLLDGNQLSVVVDQLFRMQKS 275
            ..:.|.::    |.:..|.:|||..|..:.|..::||.:.||..:.:..|.::.:....|....|
  Fly   255 DALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGS 319

  Fly   276 LNHLDLSYNRLAKVPNDSFLQLTNLTFLDLSYNKLVRLEPQSI--RSLSNLLTLNISGNVLMDLR 338
            |..|.|.||.:.::...:|..|.||..||||||.|..||.|..  .:|..:..||::||.:..| 
  Fly   320 LRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHL- 383

  Fly   339 EMRETFEPLIYYFFLTCSKLFFQLIPQLTHLAIADMGTMPVGLLHPFKQLRYLNISGNSLNNTAL 403
                  .||.:      |.|                         ||  |.||.:..|.|.:..:
  Fly   384 ------HPLAF------SSL-------------------------PF--LEYLKLGHNELKSLDV 409

  Fly   404 EVIDPCRELEFLDLSRNQLHGISEDTVLRIQGIRNVRLDNNPL 446
            .:..|.|.|:.|.|..|.|..|:.|.:..:..::.:.:|||.|
  Fly   410 RMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRL 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 4/22 (18%)
leucine-rich repeat 108..131 CDD:275380 7/33 (21%)
LRR_8 131..190 CDD:290566 21/66 (32%)
leucine-rich repeat 132..155 CDD:275380 7/30 (23%)
LRR_RI 151..422 CDD:238064 76/276 (28%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
LRR_8 178..262 CDD:290566 24/87 (28%)
leucine-rich repeat 180..203 CDD:275380 8/22 (36%)
leucine-rich repeat 204..251 CDD:275380 13/50 (26%)
leucine-rich repeat 252..275 CDD:275380 3/22 (14%)
LRR_8 274..334 CDD:290566 25/61 (41%)
leucine-rich repeat 276..299 CDD:275380 7/22 (32%)
LRR_4 298..342 CDD:289563 18/45 (40%)
leucine-rich repeat 300..323 CDD:275380 12/24 (50%)
leucine-rich repeat 388..411 CDD:275380 6/22 (27%)
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 41/159 (26%)
LRR_8 104..164 CDD:290566 15/66 (23%)
leucine-rich repeat 106..129 CDD:275380 7/28 (25%)
leucine-rich repeat 130..153 CDD:275380 5/22 (23%)
leucine-rich repeat 154..195 CDD:275380 9/41 (22%)
LRR_RI 194..455 CDD:238064 83/299 (28%)
LRR_8 194..254 CDD:290566 18/59 (31%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 8/22 (36%)
leucine-rich repeat 244..267 CDD:275380 4/22 (18%)
LRR_8 271..330 CDD:290566 18/58 (31%)
leucine-rich repeat 272..295 CDD:275380 8/22 (36%)
leucine-rich repeat 296..319 CDD:275380 3/22 (14%)
LRR_8 319..380 CDD:290566 25/60 (42%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 12/24 (50%)
LRR_8 368..428 CDD:290566 22/99 (22%)
leucine-rich repeat 370..393 CDD:275380 9/60 (15%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.