DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and Lapsyn

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster


Alignment Length:380 Identity:89/380 - (23%)
Similarity:148/380 - (38%) Gaps:95/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 LKYLDLSGNPLQ-DLQPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNEFKFLDK 243
            |:.|..:|..:| :::...:..:.:|..::|.:..||:: ||  ||...:..|||..|..:.|..
  Fly    14 LQLLHSAGFIIQSEVRKCTYGHIDKLLRIRCYDLDLKEV-PQ--NLKSSVEVLDLSHNRIRKLKT 75

  Fly   244 DEFR---DVKRLTKVLLDGNQLSVVVDQLFRMQKSLNHLDLSYNRLAKVPNDSFLQLTNLTFLDL 305
            ..|:   |:|.|  :|.|...|||.|. .|....||..:|||.|.|..:|.:.| ||..|..|.:
  Fly    76 SSFQRYTDIKFL--MLYDNMILSVEVG-TFEPLTSLQEIDLSNNGLTTIPLELF-QLPRLRNLYI 136

  Fly   306 SYNKLVRLEPQSIRS--LSNLLTLNISGNVLMDLREMRETFEPLIYYFFLTCSKLFFQLIPQLTH 368
            ..|:|..|..|::..  .:.|..||::|..|.:|                               
  Fly   137 DSNELTSLNLQALEKPIRAPLEYLNVAGCELQEL------------------------------- 170

  Fly   369 LAIADMGTMPVGLLHPFKQLRYLNISGNSLNNTALEVIDPCRELEFLDLSRNQLHGISEDTVLRI 433
               .|:|.:|        :|..||.|.|.|.|..::.:.....|:.:||:::||           
  Fly   171 ---PDLGILP--------KLWQLNASMNPLQNFRIDSLANMCHLQVIDLTKSQL----------- 213

  Fly   434 QGIRNVRLDNNPLICDECHMGKLINVVRQLQWKWDTYPICFLPKSLRGAEI-NNLDING--LHTC 495
                           .:|...::.|.:..|.......|:|.....:|...: .|..|:.  ..:|
  Fly   214 ---------------SQCGCQQVTNHLMMLGASPKFVPVCLEALDIRECPLPYNRTIHSPTFASC 263

  Fly   496 LTFITDEEQNAASTSYNFLEHGGLNTLAILGGIIFVLIAVIILSLVACFSKNRAR 550
            .|.:    |.|.:.|:.....|      ..||:.|||: ::|..::.|..|...|
  Fly   264 QTTL----QFAETRSFWLFGAG------CFGGVCFVLL-IVIFCVIHCRRKRAQR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
LRR_8 131..190 CDD:290566 3/9 (33%)
leucine-rich repeat 132..155 CDD:275380
LRR_RI 151..422 CDD:238064 64/247 (26%)
leucine-rich repeat 156..179 CDD:275380
LRR_8 178..262 CDD:290566 23/85 (27%)
leucine-rich repeat 180..203 CDD:275380 4/23 (17%)
leucine-rich repeat 204..251 CDD:275380 15/49 (31%)
leucine-rich repeat 252..275 CDD:275380 8/22 (36%)
LRR_8 274..334 CDD:290566 21/61 (34%)
leucine-rich repeat 276..299 CDD:275380 10/22 (45%)
LRR_4 298..342 CDD:289563 12/45 (27%)
leucine-rich repeat 300..323 CDD:275380 6/24 (25%)
leucine-rich repeat 388..411 CDD:275380 7/22 (32%)
LapsynNP_611561.1 leucine-rich repeat 39..59 CDD:275380 8/22 (36%)
LRR_8 58..118 CDD:290566 22/62 (35%)
leucine-rich repeat 60..83 CDD:275380 6/22 (27%)
leucine-rich repeat 84..107 CDD:275380 9/25 (36%)
LRR_RI <94..>249 CDD:238064 49/224 (22%)
LRR_8 106..167 CDD:290566 21/61 (34%)
LRR_4 106..145 CDD:289563 15/39 (38%)
leucine-rich repeat 108..130 CDD:275380 10/22 (45%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
leucine-rich repeat 157..178 CDD:275380 9/62 (15%)
leucine-rich repeat 179..202 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.