DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and swi2

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_611247.3 Gene:swi2 / 37010 FlyBaseID:FBgn0034262 Length:499 Species:Drosophila melanogaster


Alignment Length:494 Identity:106/494 - (21%)
Similarity:182/494 - (36%) Gaps:146/494 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GGLNSLLSPNELDVDVKVIIIRGPRNSITIGPALRQFMKLEILRITDSNLPAIGAESFWGLKYLR 109
            ||:|:|.:.|:          .|..:.:.  |||...:         ...|..|...|..|:.|.
  Fly    87 GGMNNLAALNQ----------SGKLSRVQ--PALEMLL---------CGWPKDGLNHFRDLQKLP 130

  Fly   110 ILDLSKNNITNITENNFRGQDNLLEL---DLSKNKVLRMASSTFRHLTDLRRLNLADNSIVE--- 168
            .|.......:..||..|...: :|||   ::|...:..::|.||:.:..|:.|:|..|.:::   
  Fly   131 RLRSLTIEYSGFTEFKFDFPE-MLELHTINISWTNLSYISSRTFKRVHPLKVLDLRWNQLIQLDG 194

  Fly   169 --LVQRNFFMLSRLKYLDLSGNPLQDLQPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSEL 231
              |:.|||      :.|.|:|||.                    ||        ..|...||.:.
  Fly   195 PLLLPRNF------EQLYLAGNPW--------------------NC--------TRNFKWLLLQP 225

  Fly   232 DLGRNEFKFLDKDEFRDVKRLTKVLLDGNQLSVVVDQLFRMQKSLNHLD------LSYNRLAKVP 290
            :.||   ..:|:||.....|..|   :...|.|:..:|...::..:|.|      |.::.|.|  
  Fly   226 EKGR---LVVDRDELICTDRKYK---ERQMLMVMHYKLELKRQCQSHEDLRNCTCLMHHILPK-- 282

  Fly   291 NDSFLQLTNLTFLDLSYNKLVRLEPQSIRSLSNLLTLNISGNVLMDLREMRETFEPLIYYFFLTC 355
              :.:.|..:....|.:::|....|      .|..||.|:.|::.|:..:|:.            
  Fly   283 --THIPLYTVNCSHLQFHRLPDFLP------DNTTTLVINDNMISDINPLRDN------------ 327

  Fly   356 SKLFFQLIPQLTHLAIADMGTMPVGLL------HPFKQLRYLNISGNSLNNT---ALE-VIDPCR 410
                    |...|:....:....:..:      :..:..|.||:.||:|...   ||: .:|...
  Fly   328 --------PHYRHVVDMQLENNQISNVDNLEDTYWLQNFRLLNLRGNNLRKLHVYALDNALDDNE 384

  Fly   411 ELEFLDLSRNQLH-----GISEDTVLR-----IQGIRNV----RLDNNPLICDECHMGKLINVVR 461
            ....|.||||..|     |.....:|.     ::...||    |||::.|      :.|::.:.|
  Fly   385 NANLLLLSRNPWHCTCKFGSRMRELLTKYKDIVRDAWNVSCTYRLDDDQL------LAKVLTLSR 443

  Fly   462 QLQWKWDTYPICFLPKSLRGAEINNLD-INGLHTCLTFI 499
            |        .:|.|... .|.:|:.:| :||:...|.|:
  Fly   444 Q--------EMCNLSVE-GGTQIHPIDWLNGVLASLIFL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 4/22 (18%)
leucine-rich repeat 108..131 CDD:275380 5/22 (23%)
LRR_8 131..190 CDD:290566 19/66 (29%)
leucine-rich repeat 132..155 CDD:275380 7/25 (28%)
LRR_RI 151..422 CDD:238064 60/291 (21%)
leucine-rich repeat 156..179 CDD:275380 8/27 (30%)
LRR_8 178..262 CDD:290566 17/83 (20%)
leucine-rich repeat 180..203 CDD:275380 5/22 (23%)
leucine-rich repeat 204..251 CDD:275380 10/46 (22%)
leucine-rich repeat 252..275 CDD:275380 4/22 (18%)
LRR_8 274..334 CDD:290566 14/65 (22%)
leucine-rich repeat 276..299 CDD:275380 6/28 (21%)
LRR_4 298..342 CDD:289563 9/43 (21%)
leucine-rich repeat 300..323 CDD:275380 3/22 (14%)
leucine-rich repeat 388..411 CDD:275380 9/26 (35%)
swi2NP_611247.3 LRR <117..384 CDD:227223 70/337 (21%)
leucine-rich repeat 132..154 CDD:275378 4/22 (18%)
leucine-rich repeat 155..178 CDD:275378 5/22 (23%)
leucine-rich repeat 179..201 CDD:275378 5/21 (24%)
leucine-rich repeat 202..214 CDD:275378 6/37 (16%)
leucine-rich repeat 287..307 CDD:275378 4/25 (16%)
leucine-rich repeat 308..332 CDD:275378 7/43 (16%)
leucine-rich repeat 333..357 CDD:275378 0/23 (0%)
leucine-rich repeat 358..385 CDD:275378 9/26 (35%)
leucine-rich repeat 386..398 CDD:275378 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.