DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and ISLR

DIOPT Version :10

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_005536.1 Gene:ISLR / 3671 HGNCID:6133 Length:428 Species:Homo sapiens


Alignment Length:465 Identity:96/465 - (20%)
Similarity:161/465 - (34%) Gaps:158/465 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 LDLSYNRLAKVPNDSFLQLTNLTFLDLSYNKLVRLEPQSIRSLSNLLTLNISGNVLMDLREMRET 343
            |.||.|||..:|..:|.::..|..|.|::|::..:...::.|||:|.:|::|.|::.|       
Human    55 LSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISD------- 112

  Fly   344 FEPLIYYFFLTCSKLFFQLIPQLTHLAIADMGTMPVGLLHPFKQLRYLNISGNSLNNTALEVIDP 408
                                     .|.:|        ||....|:.|.:..|.|.....:....
Human   113 -------------------------FAWSD--------LHNLSALQLLKMDSNELTFIPRDAFRS 144

  Fly   409 CRELEFLDLSRNQLHGISEDTVLRIQGIRNVRLDNNPLICDECHMGKLINVVRQLQWKWDTYPIC 473
            .|.|..|.|:.|:||.::|.|...:..:.:::::.||..| .|      .:|....|        
Human   145 LRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINENPFDC-TC------GIVWLKTW-------- 194

  Fly   474 FLPKSLRGAEINNLDINGLHTCLTFITDEEQNAASTSYNFLEHGGLNTLAILGGIIFVLIAVIIL 538
                             .|.|.::.  .|:.|.|.||.:.|:...|:.|..|             
Human   195 -----------------ALTTAVSI--PEQDNIACTSPHVLKGTPLSRLPPL------------- 227

  Fly   539 SLVACFSKN-RARYYTRED--------------HLNGSESKCLEKNLEATT----ITTLGNGSSP 584
               .|.:.: :..|...:|              .::|..:..|..:::..:    ||:...|   
Human   228 ---PCSAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVG--- 286

  Fly   585 TTTTTLTLATSPAAPNGPK----TNGQGL------------------SLSPANGS------TPVH 621
              |....|..:|.|.:.|:    .||..|                  .|..|..|      ||..
Human   287 --TDGRALPGTPVASSQPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGE 349

  Fly   622 GISDDKGKEINFTFPVDDRVC-TID-ELMPSPPPPPQQHPHPNMGSLMYSVSHSPNSATTLAAVA 684
            |..|..|:..:.. .|:.:.| |:| |:.||       .|..|:..:..|.:.:|.     ||||
Human   350 GGEDTLGRRFHGK-AVEGKGCYTVDNEVQPS-------GPEDNVVIIYLSRAGNPE-----AAVA 401

  Fly   685 AAAT-VIPPG 693
            .... .:|||
Human   402 EGVPGQLPPG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 LRR 69..>446 CDD:443914 38/166 (23%)
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380
leucine-rich repeat 156..179 CDD:275380
leucine-rich repeat 180..203 CDD:275380
leucine-rich repeat 204..251 CDD:275380
leucine-rich repeat 252..275 CDD:275380
leucine-rich repeat 276..299 CDD:275380 8/19 (42%)
leucine-rich repeat 300..323 CDD:275380 6/22 (27%)
leucine-rich repeat 388..411 CDD:275380 4/22 (18%)
ISLRNP_005536.1 leucine-rich repeat 32..51 CDD:275380
LRR <50..>182 CDD:443914 38/166 (23%)
LRR 1 51..72 8/16 (50%)
leucine-rich repeat 52..75 CDD:275380 8/19 (42%)
LRR 2 75..96 4/20 (20%)
leucine-rich repeat 76..99 CDD:275380 6/22 (27%)
LRR 3 99..122 9/62 (15%)
leucine-rich repeat 100..123 CDD:275380 9/62 (15%)
LRR 4 123..144 4/20 (20%)
leucine-rich repeat 124..147 CDD:275380 4/22 (18%)
LRR 5 147..168 8/20 (40%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
PCC 153..>227 CDD:188093 22/107 (21%)
Ig 239..340 CDD:472250 16/105 (15%)
Ig strand B 253..257 CDD:409546 0/3 (0%)
Ig strand C 266..270 CDD:409546 1/3 (33%)
Ig strand E 310..314 CDD:409546 1/3 (33%)
Ig strand F 324..329 CDD:409546 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.